Maxalimpex.net Favicon Maxalimpex.net

Maxalimpex.net Website Thumbnail
Checking...
Alloy Sheets Supplier in Mumbai,Aluminium Alloy Sheets Manufacturer India,Maharashtra
Low trust score
Add a review Change category Claim this site
Supplier,manufacturer of Alloy Sheets,Aluminium Alloy Sheets from MAXAL IMPEX. Buy Alloy Sheets,Aluminium Alloy Sheets online at best prices from Mumbai,Maharashtra,India


Domain summary

Domain label
maxalimpex
Domain extension
net
Domain registered:
2016-04-21
Domain updated:
2019-04-04
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is maxalimpex.net ranked relative to other sites:

Percentage of visits to maxalimpex.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Maxalimpex.net registered?
A: Maxalimpex.net was registered 4 years, 5 months, 5 days, 22 hours, 47 minutes, 58 seconds ago on Thursday, April 21, 2016.
Q: When was the WHOIS for Maxalimpex.net last updated?
A: The WHOIS entry was last updated 1 year, 5 months, 3 weeks, 1 day, 22 hours, 47 minutes, 58 seconds ago on Thursday, April 4, 2019.
Q: What are Maxalimpex.net's nameservers?
A: DNS for Maxalimpex.net is provided by the following nameservers:
  • server1.trade-india.com
  • server2.trade-india.com
Q: Who is the registrar for the Maxalimpex.net domain?
A: The domain has been registered at TUCOWS DOMAINS INC..
Q: What is the traffic rank for Maxalimpex.net?
A: Maxalimpex.net has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Maxalimpex.net each day?
A: Maxalimpex.net receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Maxalimpex.net resolve to?
A: Maxalimpex.net resolves to the IPv4 address 149.129.147.37.
Q: In what country are Maxalimpex.net servers located in?
A: Maxalimpex.net has servers located in the India.
Q: What webserver software does Maxalimpex.net use?
A: Maxalimpex.net is powered by Apache/2.4.10 (Debian) webserver.
Q: Who hosts Maxalimpex.net?
A: Maxalimpex.net is hosted by TIME dotCom Berhad in India.
Q: How much is Maxalimpex.net worth?
A: Maxalimpex.net has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Maxalimpex.net?

Maxalimpex.net Hosting Provider Information

Hosted IP Address:149.129.147.37
Hosted Hostname:149.129.147.37
Service Provider:TIME dotCom Berhad
Hosted Country:IndiaIN
Location Latitude:20.0063
Location Longitude:77.006
Webserver Software:Apache/2.4.10 (Debian)

Is "TIME dotCom Berhad" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Maxalimpex.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 08 Sep 2020 11:21:28 GMT
Server: Apache/2.4.10 (Debian)
X-Tradeindia-Request-GUID: modperl-07]-6ab02f43-fd92-4bcb-be79-df2af373e3af
X-Tradeindia-SMgmt: Yes
Content-Type: text/html
Via: 1.1 www.maxalimpex.net
Vary: Accept-Encoding
Content-Encoding: gzip
Connection: close
Transfer-Encoding: chunked

Maxalimpex.net Domain Nameserver Information

HostIP AddressCountry
server1.trade-india.com 149.129.136.237
server2.trade-india.com 149.129.146.193


Need to find out who hosts Maxalimpex.net?


WhoIs information for Maxalimpex.net

 Domain Name: MAXALIMPEX.NET
Registry Domain ID: 2023150234_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucowsdomains.com
Updated Date: 2017-10-31T19:55:42Z
Creation Date: 2016-04-21T10:48:34Z
Registry Expiry Date: 2019-04-21T10:48:34Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: SERVER1.TRADE-INDIA.COM
Name Server: SERVER2.TRADE-INDIA.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-09-05T06:57:47Z

Maxalimpex.net Free SEO Report

Website Inpage Analysis for Maxalimpex.net

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

26 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-76630243-15

Links - Internal

28:
  1. Send Inquiry
    http://maxalimpex.net/contact-us.html
  2. No text
    http://maxalimpex.net/
  3. English
    http://maxalimpex.net/utils/set_language.html?lang=en&key=catalog_70112&return_url=
  4. Spanish
    http://maxalimpex.net/utils/set_language.html?lang=es&key=catalog_70112&return_url=
  5. French
    http://maxalimpex.net/utils/set_language.html?lang=fr&key=catalog_70112&return_url=
  6. German
    http://maxalimpex.net/utils/set_language.html?lang=de&key=catalog_70112&return_url=
  7. Italian
    http://maxalimpex.net/utils/set_language.html?lang=it&key=catalog_70112&return_url=
  8. Chinese (Simplified)
    http://maxalimpex.net/utils/set_language.html?lang=zh_CN&key=catalog_70112&return_url=
  9. Japanese
    http://maxalimpex.net/utils/set_language.html?lang=ja&key=catalog_70112&return_url=
  10. Korean
    http://maxalimpex.net/utils/set_language.html?lang=ko&key=catalog_70112&return_url=
  11. Arabic
    http://maxalimpex.net/utils/set_language.html?lang=ar&key=catalog_70112&return_url=
  12. Portuguese
    http://maxalimpex.net/utils/set_language.html?lang=pt&key=catalog_70112&return_url=
  13. Home Page
    http://maxalimpex.net/
  14. Company Profile
    http://maxalimpex.net/company-profile.html
  15. Our Products
    https://www.maxalimpex.net/products.html
  16. Aluminium Products
    http://maxalimpex.net/aluminium-products.html
  17. Aluminium Bar
    http://maxalimpex.net/aluminium-bar.html
  18. Sheet Metal
    http://maxalimpex.net/sheet-metal.html
  19. Sheet Metal Parts
    http://maxalimpex.net/sheet-metal-parts.html
  20. Aluminium Pipes
    http://maxalimpex.net/aluminium-pipes-tubes-2652538.html
  21. Aluminium Ingots
    http://maxalimpex.net/aluminium-ingots.html
  22. Aluminium Coil
    http://maxalimpex.net/aluminium-coil.html
  23. Ingot
    http://maxalimpex.net/ingot.html
  24. Contact Us
    http://maxalimpex.net/contact-us.html
  25. Get A Quote
    http://maxalimpex.net/contact-us.html
  26. See More...
    http://maxalimpex.net/company-information.html
  27. Send Inquiry
    http://maxalimpex.net/inquiry.html
  28. Site Map
    http://maxalimpex.net/sitemap.html

Links - Internal (nofollow)

1:
  1. No text
    http://maxalimpex.net/

Links - Outbound

34:
  1. Aluminium Rods
    https://maxalimpex.net.tradeindia.com/aluminium-rods-2652527.html
  2. Aluminum Plates
    https://maxalimpex.net.tradeindia.com/aluminum-plates-2652528.html
  3. Aluminum Square Rods
    https://maxalimpex.net.tradeindia.com/aluminum-square-rods-2652529.html
  4. Aluminum Coil Patti
    https://maxalimpex.net.tradeindia.com/aluminum-coil-patti-2652530.html
  5. Aluminum Alloy Plates
    https://maxalimpex.net.tradeindia.com/aluminum-alloy-plates-2652533.html
  6. Aluminum Flats
    https://maxalimpex.net.tradeindia.com/aluminum-flats-2652536.html
  7. Aluminium Patta
    https://maxalimpex.net.tradeindia.com/aluminium-patta-2652537.html
  8. Aluminium Angles
    https://maxalimpex.net.tradeindia.com/aluminium-angles-2652539.html
  9. Aluminum Channels
    https://maxalimpex.net.tradeindia.com/aluminum-channels-2652540.html
  10. Aluminum Roofing Sheets
    https://maxalimpex.net.tradeindia.com/aluminum-roofing-sheets-2652542.html
  11. Aluminum Sections
    https://maxalimpex.net.tradeindia.com/aluminum-sections-2652543.html
  12. Aluminium Solid Bars
    https://maxalimpex.net.tradeindia.com/aluminium-solid-bars-2531876.html
  13. Aluminium Round Bar
    https://maxalimpex.net.tradeindia.com/aluminium-round-bar-2531877.html
  14. Aluminum Hex Bars
    https://maxalimpex.net.tradeindia.com/aluminum-hex-bars-2652544.html
  15. Aluminum Alloy Sheets
    https://maxalimpex.net.tradeindia.com/aluminum-alloy-sheets-2652534.html
  16. Aluminium Alloy Sheets
    https://maxalimpex.net.tradeindia.com/aluminium-alloy-sheets-2531874.html
  17. Aluminum Sheets
    https://maxalimpex.net.tradeindia.com/aluminum-sheets-2652535.html
  18. Aluminium Chequered Sheets
    https://maxalimpex.net.tradeindia.com/aluminium-chequered-sheets-2652541.html
  19. Aluminum Reflector Sheets
    https://maxalimpex.net.tradeindia.com/aluminum-reflector-sheets-2652531.html
  20. 1s Aluminium Sheets
    https://maxalimpex.net.tradeindia.com/1s-aluminium-sheets-2652545.html
  21. Aluminium Pipes Tubes
    https://maxalimpex.net.tradeindia.com/aluminium-pipes-tubes-2652538.html
  22. Aluminium Ingots
    https://maxalimpex.net.tradeindia.com/aluminium-ingots-2690135.html
  23. Aluminium alloy ingots
    https://maxalimpex.net.tradeindia.com/aluminium-alloy-ingots-2690136.html
  24. Aluminium 1s Coils
    https://maxalimpex.net.tradeindia.com/aluminium-1s-coils-2652526.html
  25. Industrial Aluminium Coil
    https://maxalimpex.net.tradeindia.com/industrial-aluminium-coil-2531873.html
  26. Aluminium Slitting Coil
    https://maxalimpex.net.tradeindia.com/aluminium-slitting-coil-2531875.html
  27. Aluminum Coil
    https://maxalimpex.net.tradeindia.com/aluminum-coil-2652532.html
  28. No text
    https://maxalimpex.net.tradeindia.com/aluminium-slitting-coil-2531875.html
  29. No text
    https://maxalimpex.net.tradeindia.com/aluminium-alloy-sheets-2531874.html
  30. No text
    https://maxalimpex.net.tradeindia.com/industrial-aluminium-coil-2531873.html
  31. No text
    https://maxalimpex.net.tradeindia.com/aluminium-round-bar-2531877.html
  32. No text
    https://www.tradeindia.com
  33. (Terms of Use)
    https://www.tradeindia.com/about-us/terms/terms_01.html
  34. Infocom Network Ltd.
    https://www.tradeindia.com/about-us/

Links - Outbound (nofollow)

0:

Keyword Cloud for Maxalimpex.net

15pxtextalign0px 0pxwidth0px 6px 0pxtextalignautomaxwidth100marginsolidleft repeatxborderradiusboldtextalign lefttextdecoration0textalignpointerfloatmarquee0 table tdcontactdetailautouidatepickerrtl303f9ffontsize 18pxfontweightauiwidgetcontent18paddingprocentertextdecoration nonenav li2pxleftcolor 000fontsize 18pxfontweight0pxtextalign centerwidth 1000px 5pxrightmargintranslate3d0 0000textdecorationahover textdecoration underline0width10px 6px 10pxheadercacacacolor0pxposition relativewidthimportantpaddingfreetop left01pointereventsborderbold 14px arialmatterpart0pxtextalign leftwidth 270pxlucidatable18pxfontweight boldmarginrgba0 0 0urlhttpstiimgtistaticcomcatalogstemplate65934enquirybgjpg top left10pxleftlogomain float5pxwebkitborderradiuslefttextdecoration15pxfontweight boldpaddingfffffffloatmozborderradiustopleftpageview1pxrangeslidesperview 3background4d4d4d padding3pxmozboxsizing20px 0000fontsize 12pxfontweight normalmargin192px145px 5pxwidthbottomcursor autoopacityeaseinoutotransitionuidatepickerbuttonpane buttonfloatcolor 303f9ffontsize5pxtextalign leftprodimgcontbackgroundcolor ffffloatmargin 0paddingfffdisplay30pxfontsize 14px fontweightabsolutetop5pxtophiddenpadding 0px0pxpadding 4pxwidthboldtextalignpadding3px 5px borderradius3pxarial helvetica sansserifmarginborderradius3pxbackground urlhttpstiimgtistaticcomcatalogstemplate65934catepngbackgroundborderbottom 1px3px 3px000fontsize 12pxfontweight12pxfontstylerelativetextalign50marginleftrightfontfamilynonecolor000000textdecoration noneffftextdecorationborderbottom 1px dottedswiperpaginationbulletlefttextdecoration noneboxreadmoreli backgroundimage10px 0langtranslator dropdown ddcontactheadingfffborderbottomnonemargin 0pxoverflowconame0pxoverflownonetexttransform uppercase0pxtextalign leftourproducts000display blockfontsizealtprolinkcontbackground urlhttpstiimgtistaticcomcatalogstemplate65934catepng norepeat000fontsize 12pxpadding 6pxh10px 0px 5px5em 5emmarquee0 table14px arialahover208pxblockfloat18pxliststyletype nonemargin100zindexheight2 0li ahover colorverdana helveticapronextprodmaincontainerfloat nonetextalign centerffful displayul floatrelativetop1px dotted dadadafloatrightmargin 0paddingaltcateproddescrcontfffffffontfamily arialdisplay nonebottom 10pxleftfontsizeimagepart2urlhttpstiimgtistaticcomcatalogstemplate65934enquirybghoverjpgleftmargin 0pxpadding20pxnonetextalign center0pxpadding 0pxtextalign centerfloat rightmargin255 25514pxfontweight normal0px 0pxtextalign5pxcolor fffffffont boldlangtranslator dropdown dt5pxcolorborder 0px solid000marginbaltcateprodimgcontnormalproinquirybtnsansseriffontsize 12pxmargin12pxmargin 0pxpaddingcalltoactionbuttons2000margin 0pxpadding 0pxdadadafloat nonemargin0pxtextalign justifyfloat nonemargin 0pxoverflowe28300color ffffloatalloy sheetscolor 025885textdecoration5px rgba50rightheightnormaltextdecorationcolor 000000fontsize 12pxtextdecoration3emmarginleftrepeatxborderradius 3pxcolor ffffffdisplay0padding 0textalign3px 4pxfloat rightmargin 00textalign left22pxmarginjustify6pxtextalignregionallang colorffffff textdecorationnone0px solidul liststyletypergba255872525borderbottom 1px solidfloatnoneborderright0width autoheightrepeatxborderradius 5pxcolor fffffffontfloat nonemarginuitabsnav libackgroundcolor fffborderbottom 1px0height0px 1px rgba00width 1003px 4px rgba0textdecorationnone background4d4d4d padding3pxaltprodimgconthovernonewidth0pxpadding 0pxtextaligncenterwidth 325pxtextalign000fontsize 12pxpadding025s easeinoutwebkittransitionnoneuidatepickeravisited colorsolid 4f2b06segoemozborderradius 5pxwebkitborderradiushelvetica sansseriffontsize 14pxfontweight872525backgroundcolor 872525borderbottomrgba01px rgba0leftmargin 0pxpadding 4pxwidthimgdisplayautomargin2pxuidatepickerbuttonpanegrande sansseriffontsizeingots aluminiummozborderradiusimportantmargin 0fffffftextdecorationaluminium alloy sheets9pxleftmozlineargradienttop025s easeinoutotransitionhelvetica sansseriffontsize 12pxfontweightliststyletype0px 5px rgba50margin 0pxpadding 0pxtextalignul backgroundcolor 303f9ffontsize 18pxfontweightabsoluteleftcenter0pxpadding 6px 0pxrepeatxborderradius 3pxcolorffffffcolor7pxwidth1px rgba255fffborder 1px0 autopaddingautoopacitycursor pointerheight0 auto 20pxpaddingmargin 00px 7pxbackgroundrepeatnormaltextdecoration none12pxtextdecoration underline122 0 0searchfontsize 14pxh1 coloraltproddescriptionsansserifmargin 0pxpadding 8pxcolor 000000textdecoration none12pxmargin4f2b06sans unicode lucidaunderline2emahover color 000margin000fontsize 12pxmargin8px 15px 8pxboldmargin 0pxmyriad0px 0pxtextalign left0px 0px 0pxtextalign6px 0px205px 0px 5pxahover mozborderradius 5pxwebkitborderradiusdt5px000fontsize 12pxpadding 5pxli linorepeat right0pxpadding 6px303f9fcolor fffdisplay blockpaddingrepeatxborderradiusautopaddingdadadafloatnormalmargin4px rgba0 2bottom 10pxleft 0width0pxoverflow hiddenpadding 0pxuitabsnav liuitabsselected acursorswiperslidealtprodcatdescrgacreatehelvetica sansseriffontsize 18pxfontweightnewbackground 303f9fcolor fffdisplaybackgroundimagenone importantmargin 020px 1pxsansreadmore872525borderbottomhiddenpadding 10px 6pxffffffborderleftwidth0 10pxahover background 303f9fcolor175pxborderbottom 1pxbackgroundcolor 303f9fcolorheaderright303f9ffontsize0px 0pxoverflowborderbottom 1px solideaseinoutwebkittransitionfloat leftmargina5a7b3fontfamilyfffmargin 0pxpadding14px0 2 0872525backgroundcolor10pxtextdecoration nonecolor fffffftextdecoration none0px langtranslator700colorboldmargin 0pxpadding1px solid 4f2b06liresponsivetab5pxlefttdtablewidthmoztransitionblocklineheight4fffffftextdecoration nonenextcolor fffffftextdecorationurlhttpstiimgtistaticcomcatalogstemplate65934enquirybgjpginnerbannerlangtranslator dropdown6px 0pxtextalign justifyimportant0px 20px000margin 0pxpaddingproductbigimgcontainer15px 8pxsolid e28300color ffffloatlihovermarquee0ffffloat rightmarginunicode lucidaswiperpaginationbulletactiveall100margin 0pxoverflowalloy sheets aluminumleftlineheight 18pxliststyletype nonemargin0 5pxnonemargin 0pxoverflow hiddenpadding10px 10pxverdana helvetica sansseriffontsize14pxfontweight normalpaddingcolor 000displaysolid 303f9fcolor 303f9ffontsizeahover backgroundblockpadding 10pxtextdecorationleft repeatxborderradius 5pxcolorhtml catnameheadlucida sanscolorffffff50widthcateprodimgcont1px dottednone ourproducts112pxcatnameheadimagepartnormalmargin 0pxpadding000fontsize 18pxfontweightnormalpadding 8px0pxpadding1px rgba1sansseriffontsizelefttextdecorationnonepaddingfontsize 14pxfontweightsansseriffontsize 14pxfontweightrgba0 0sansseriffontsize 12pxfontstyle normalfontweightcall me freeuidatepickerbuttonpaneclearcenterwidthbacklinkpadding3px 5pxnormalfontweight normaltextdecorationdisplayarial helvetica sansseriffontsizebackground fff0px 1px5px 0fffmargin915pxarial verdanaaltotherprodmaincon10px0px 0px 0px1emprodimgconthover150pxtextalign centermoztransition all18pxfontweightuitabsnav liuitabsselectedacursorblockmargin 0pxpaddingpointerheight0pxpadding 0pxwidth0px 0fontweight0 0 10px0borderbottomuibuttontextuibuttontexticons uibuttontextpaddingfloat noneboldpadding20px 1px rgba1872525borderbottom 1pxunicodebold 14px0positionauiwidgetheaderboldpadding 5pxtextalign leftnonetexttransformsansseriffontsize 12pxfontstyle15px 8px 15pxtextalignlogodropdown dd ul6px 10pxsheets aluminumfloatnoneborderright0widthboldli ahover0pxpadding 8px4px rgba00px 0pxoverflow hiddenpadding30pxpadding160px15pxtextalign centertextdecorationlanguagenoneswipercontainerautoheight1px rgba1 110px 0px14px arial helveticasansseriffontsize 11pxfontweight224pxuidatepickergroupmiddlecateproddescrcontdropdown ddboldtextdecoration none2em 2em100fontsizealtprolinkcont li0px 0pxpositionwesolid e28300coloruibuttontextpadding303f9fcolor 303f9ffontsize 18pxfontweight20pxpaddingfloat rightmargin 0pxtop left repeatxborderradiussansserifmargin3px 3px 4pxlogomaincolor 000000fontfamilyaluminumnone navcolor 343434maintext000000textdecoration12pxpadding 6px 0pxtopbarcolor 343434 langtranslator000000fontfamilyrightprod liurlhttpstiimgtistaticcomcatalogstemplate65934catepng norepeat rightverdana arial helveticamedia maxwidthtextdecorationnone background4d4d4drgba1nonefloat50pxfffborderbottom 1px solidcentertextdecorationparabox130pxwidth 100robotoleftmargin0px 12px10px 6px025s96pxenquirybtnpunchline0 0padding 0urlhttpstiimgtistaticcomcatalogstemplate65934enquirybghoverjpg topboldmarginul float leftlineheighturlhttpstiimgtistaticcomcatalogstemplate65934catepnguiaccordionheaderauto 20pxpaddingcolorffffff textdecorationnone5pxbackground urlhttpstiimgtistaticcomcatalogstemplate65934enquirybghoverjpg2pxuidatepickerproname2imgsend025s easeinout20pxwidth0pxtextalign centerwidth 32color 000000fontfamily arialbackgroundcolor fffmargin 0pxpadding0 autowidthauto10px 0pxpaddingnonemargin1px solid nonefloatrgba255 255autoheight 175pxborderbottomnormalfontweightcall me0px 12pxtextdecoration noneeaseinoutwebkittransition all0px 5px 0pxtextalignffffontweightspandisplayhiddencmftext6pxwidthaltprolinkcontaltuibuttontextuibuttontexticonsinquiryul li70pxwidth3pxcolor ffffffdisplayimg height automaxwidth5px langtranslator dropdown64pxautoopacity 01pointerevents noneborder solid14pxfontweight boldlineheight2pxmargin0px 0px 20pxgetaquoteblockmargin 0pxpadding 0px518pxfontweight boldmargin 0px8px 15pxfloat leftlineheight 18pxliststyletypefffmargin 0pxpadding 4pxtextalignsendinquaryhelvetica sansserifmargin 0pxpaddingblockpadding 10pxtextdecoration none0pxpadding 8px 15pxtoptextdecorationnone100width 1000px 0px 1pxnorepeat0textdecorationsolid 303f9fcolor3pxbackground14pxfontweightautooverflowauitabsboldtextalign lefttextdecoration noneprolinkcont lifloat leftpadding7em18pxliststyletypealtcatnameheadhelvetica sansseriffontsize 12pxfontstyle0 0paddingnextandbigimgcontainer marginrighthiddenpadding025s easeinoutotransition allnextandbigimgcontainer000000fontsize 12pxtextdecorationuidatepickergroupwidthcontactnonemargin 0fffbordergrandeborder012pxfontstyle normalfontweight normaltextdecorationourproductstageaseinoutotransition all 025sfontsize 14pxfontweight normaluidatepickergrouplastsolid cacacacolorfloat leftheight1liuitabsselectedprodescriptioncontainer12pxpadding 6px03sprolink48pxverdana4em 1emuibuttonicononlycolor 000fontsize 12pxfontweightnonemargin 0pxsansserifmargin 0pxpaddinghelvetica sansserifmarginsheets000display blockfontsize 12pxmargin5px rgba50 5019pxmargin5pxwebkitborderradius 5pxbackgroundmargin 0pxpadding 0pxblockfontsize 12pxmarginffffff303f9fcolor 303f9ffontsizeboldtextdecorationwidth100noneborderd56e30000display blockmarginsend inquiry3otherprohead1prolinkcontnav ul liresponsivetabcolor 000margin 0pxpaddingahover mozborderradiusahover color fffffftextdecoration80px 0px 10px0pxposition5pxtop 0height10pxtextalign0pxpadding 4pxtextalign centeravisitedcolor0uitabsfffdisplay blockpaddingcoil5pxwebkitborderradius 5pxbackgroundcolor12pxfontweight normalmargin 0pxpaddingproname3pxbackground urlhttpstiimgtistaticcomcatalogstemplate65934enquirybgjpgahover coloruistatehighlightviewall18pxfontweight boldtextdecorationall 025s easeinoutautoopacity 01pointerevents3pxwebkitborderradius 3pxbackground urlhttpstiimgtistaticcomcatalogstemplate65934enquirybgjpgingotsmozborderradiustopleft 10pxmozborderradiustopright1px solid 303f9fcolorurlhttpstiimgtistaticcomcatalogstemplate65934enquirybgjpg top000fontsize 18pxfontweight boldtextdecorationscrollsheets aluminum sheetsnav lihover50 50grande sansseriffontsize 12pxmargin025s easeinoutwebkittransition allrelativepaddingleftheightmozborderradius 5pxwebkitborderradius 5pxbackgroundbackgroundcolorfloatnoneborderright0width autoheight 175pxborderbottomliuitabsselected acursorrgba0 2 0rgba0 2products12px1emuibuttonicononly4pxtextalign center0px 0pxdisplaynonerightmargin 0000roboto arial helveticanonemargin 0 auto12pxfontstyle normalfontweightregionallang19dd ulblockposition2px solid0pxpadding 0px 0pxprolinkcontalturlhttpstiimgtistaticcomcatalogstemplate65934catepng norepeat1px rgba0 0dotted dadadafloat18pxliststyletype nonemargin 0px0px 0pxpadding 6pxcentertexttransform100px 20px 0pxoverflowrightheight 100marginmargin 0 automaxwidthuimenuitemtiservicescenterwidth 1005pxbackgroundcolorlangtranslator6px 0pxtextalign0px 1px 1px100margin 0pxoverflow hiddenpadding10pxleft 0width 100robotofontsizebtncontsddm div0pxwidth 66uitabsnav10px 6pxwidthalloy10px 0px 10px7pxbackgroundrepeatahover color 000fontsizefloat none importantmarginaluminium alloycolor 000fontsize 12pxpaddinge28300colorusboldmargin 0px 0pxcursornonemargin 0px 0pxbackground ffffloatacolorcolor fffffffontfamily0px 0pxposition relativewidthme free15px 0clientsaltprolink3px0uidialogrepeatxborderradius 5pxcolor303f9fcolormargin 0 2socialiconrightimg height0padding 0sansseriffontsize 18pxfontweight boldmarginfloat nonemargin 08pxtitleabsolutewidth5pxwebkitborderradius 5pxbackground urlhttpstiimgtistaticcomcatalogstemplate65934enquirybghoverjpgunicode lucida grandecolor 000000fontsize11pxbackgroundrepeatul liresponsivetabboldlineheightborderbottom 0pxborder solid 1pxnormalfontweight normaltextdecoration none0pxpadding 4pxtextalignimportantpadding 0float left3pxwebkitborderradius2sddmaltcateprodcontbackground4d4d4dprevious116px 0pxtextalign centerleftoverflowfffffffontfamilyall 025s9pxheight100widthsheets aluminiumblockpadding11pxfontweightproddescrcontmore0px 10px0px 1px rgba2550textalign center12pxfontweight boldtextalign14px fontweight303f9ffontsize 18pxfontweight boldmarginborderrightabsolutezindex0px 0pxpadding3pxcolorff6405colorprolinkcontalt lihiddenpadding 0px 0px025885textdecoration6px 0px 6pxbackgroundcolor fffborder 1px100margin 0px 0px6px 10px 6pxwidthdd ul liotherprodmainconverdana arialnorepeatbordernone langtranslatorarial verdana helveticafloatcolor fffffffontfamily arialautowidthaluminiummarginrightour0px 0px 0pxpaddingrgba1 1 10pxwidth 741emtextdecoration0padding4emsansseriffontsize 12pxfontweight0pxoverflow hiddenpadding 10px000displaybackgroundcolor fffborderhtmlblockmarginhelvetica sansseriffontsize5px 0pxtextalign center000000fontsizearial helveticavisiontxthpproductnonefontsizecursor autoopacity 01pointereventsnormalpadding12pxtextdecoration01pointerevents nonerotateimgtxtnavrgba1 11px solidauitabs uitabsnav5emurlhttpstiimgtistaticcomcatalogstemplate65934enquirybghoverjpg top leftuiarialsansseriffontsize6productgallerybg5px 0pxtextalign1pxuidatepicker0px 12pxtextdecorationfloat leftlineheight211px 20px8px 15pxtextalign centertextdecorationpro arial helvetica2width000display blockmargin 0pxpaddingnonetextalign10pxbordertoprightradius20px 0pxoverflow0marginrightmargin0pxfffffffont5pxcolor fffffffont0uidatepickerall 07s0 automaxwidthbackgroundcolor fffborderbottom20pxpadding 4pxwidth 520display7pxbackgroundrepeat norepeatcolortextaligncenteruibuttontextuibuttontexticons uibuttontextpadding 4emtable tdblockfontsize 12pxmargin 0pxpadding0px 0px 0pxoverfloweaseinoutwebkittransition all 025s6px 0pxtextalign leftwidthlucida grande0normalmargin 0pxpadding 6px1px 20px 1px6px12px 0px 12pxtextdecorationvar9pxheight 9pxleftcallnorepeatcolor15pxtextalign centertextdecoration nonealtprodcatnamergba50 50rightmargin 0 0footer ulleftwidth 270pxmyriad probackgroundcolor fffmarginnoneimportantwidthsansseriffontsize 14pxfontweight normalpaddingcolor 000textdecoration10pxpaddingeaseinoutotransition all4pxwidth 52colorlucida grande sansseriffontsize343434 langtranslator dropdownmyriad pro arial343434 langtranslatorh2all 025s easeinoutotransitionsansseriffontsize 15pxfontweightrgba5012pxpadding 5px 0px3pxbackground urlhttpstiimgtistaticcomcatalogstemplate65934enquirybgjpg top0 2me4pxwidth 220px 6px0overflowrightprod128pxaltprolinkcontalt li100filter1px 0float nonepadding303f9fcolor fffdisplay0px 12pxtextdecoration underlinebgshow000000fontfamily arialnav li liauto 20pxpadding 4pxwidthuidialogbuttonpane0px 0px 0pxwidth12pxfontweight normalmargin12pxmargin 0pxpadding 6px4pxtextalign12pxfontweightfffdisplay blockpadding 10pxtextdecoration0pxpadding 0pxtextalign left0 0autoheightleftlineheight32pxnonedisplayaltenquirybtn0px 7pxbackgroundrepeat norepeatcolor12pxpadding 5px0pxpadding 0px175pxborderbottomdivleft repeatxborderradius 3pxcolorimportantmargincentertextdecoration nonewidth1px rgba255 255roboto arial1 10 importantpadding80pxbuttonfloat1px 1px 20px000fontweightblockfontweightmozborderradius 3pxwebkitborderradius 3pxbackgroundnav ul0 15px0px 0pxtextalign centerwidth2emtextalign000fontsize1uiaccordionrelativewidthprodcatnamecolor 000margin10pxwebkitbordertoprightradiusffffloat leftmargin18pxfontweight boldtextdecoration none5px borderradius3px4pxwidthnone importantmarginffffloat5pxbackground10pxtextalign left0 0 0uistateerror1px 1pxtiservices floatslidesperviewphone20pxmarginproddescriptionviewmore0pxpadding 0px 12pxddbackground ffffffborderffffffdisplayhelveticablockfontsizeborderbottom0pxoverflow hiddenpaddingaltprodimgcont0px 10px 0pxpaddingleftpaddingcenter navsearchbutton2roboto arial verdanali8px 15pxtextalignmozborderradius 3pxwebkitborderradiustextdecoration underline0px 0pxpadding 0pxwidthavisitedcolor a5a7b3fontfamilyfffborderbottom 1pxfffffffont boldspacebetweenfalseffffffdisplay blockfloat0pxpadding 4pxwidth 220px 0pxpadding 0pxtextalign10px 10px 0000000displayindustrialcolor 000fontsizemoztransition all 025s0px 12px 0pxbordertop15pxfontweight6px 0pxtextalign centerwidthsolid 1px0pxtextalign centertexttransform144pxcenterwidth autorgba50 50 50uiiconpositionfirstul240pxall 025s easeinoutwebkittransitionsendinquppercasewidth 9220px 0pxoverflow hiddenpadding30px 0swiperbuttonprev000fontsize 12pxmargin 0pxpadding4pxli uleaseinouthiddenpadding 10pxulfooterautopro arialsegoe uiarialsansseriffontsize50margintopnonemargin 0paddingwebkittransition303f9ffontsize 18pxfontweight boldtextdecoration10px 0pxpadding 6pxmedia000000fontfamily arial verdanafffborder 1px solid100margin 0pxsecondulbackground 303f9fcolorbackground4d4d4d padding3px 5px0pxpadding 4pxregionallang colorffffff5px langtranslator100backgrounddropdown100borderfooterlinks270pxboldpadding 5pxtextaligntranslate3d0sans unicodeswiperbuttonnextfffffffont bold 14px10pxtextdecorationviewallproswiperpaginationbulletactive backgroundabsoluterighthelvetica sansseriffontsize 11pxfontweightnone readmoreprodcatdescruibuttontextpadding 4em176pxcolor 000fontweightahover textdecorationrgba255 255 25512pxtextdecoration none12px 0872525backgroundcolor 872525borderbottom 1pxautoheight 175pxborderbottom 1px12pxpaddingdotted dadadafloat nonemarginmozborderradius 5pxwebkitborderradius 5pxbackgroundcolorpadding3pxspanfontsize 12pxpadding5pxbackground urlhttpstiimgtistaticcomcatalogstemplate65934enquirybghoverjpg topcolorffffff textdecorationnone background4d4d4drightmargin 0px0pxtextalign centerwidth0pxpadding 0px langtranslator0pxpadding 0pxwidth 74rightmargin 0px 0px07s175pxborderbottom 1px solidsolid nonefloatcolor 000display blockmarginli a color3pxwebkitborderradius 3pxbackground100background mozlineargradienttopdadadafloat nonemargin 0pxtrue1620pxwidth 1005px 0pxaluminum sheetsleftlineheight 18pxliststyletype0pxtextalign leftwidthdotted10pxleft 0widthlucida sans unicodemargin 0pxpaddingfunctionsansseriffontsize 18pxfontweight16pxborder 0pxmaxwidthfloat nonetextalign20pxpadding 4pxwidth6px 0pxtextalign left12px 0pxmargin 0 0height automaxwidth0pxtextalign000000fontsize 12pxtextdecoration nonepadding0mozboxshadowsendemailtextnonemargin 0padding 0rightuidatepickerrtlsearchbutton2 padding10pxmozborderradiustoprightdropdown dtarialswiperpaginationpronextprodmaincontainer float17color 000000textdecorationright0 20px

Longtail Keyword Density for Maxalimpex.net

KeywordsOccurences
0px 0px 0px39
arial verdana helvetica27
verdana helvetica sans-seriffont-size27
6px 0px 6px25
0px 6px 0pxtext-align23
margin 0pxpadding 0px19
0pxpadding 6px 0px18
arial helvetica sans-seriffont-size16
000000font-family arial verdana13
0px 0px 0pxpadding12
0px 0px 1px12
color 000000font-family arial12
hiddenpadding 0px 0px10
float nonemargin 010
0px 0px 0pxtext-align10
5px 0px 5px9
0pxoverflow hiddenpadding 0px9
0px 5px 0pxtext-align9
12px 0px 12pxtext-decoration8
0px 12px 0px8
18pxfont-weight boldtext-decoration none8
color 000font-size 12pxpadding8
0 0 08
0pxpadding 0px 12px8
helvetica sans-serifmargin 0pxpadding7
arial helvetica sans-serifmargin7
12pxpadding 5px 0px7
helvetica sans-seriffont-size 14pxfont-weight7
li a color7
nonemargin 0 auto7
14px arial helvetica7
6px 0pxtext-align center6
0pxpadding 8px 15px6
bold 14px arial6
top left repeat-xborder-radius6
0pxpadding 0pxtext-align center6
12pxfont-style normalfont-weight normaltext-decoration6
rgba255 255 2556
sans-seriffont-size 12pxfont-style normalfont-weight6
6px 0pxtext-align justify6
5px 0pxtext-align center6
8px 15px 8px6
1px rgba255 2556
helvetica sans-seriffont-size 12pxfont-style6
1px rgba0 06
0px 0px 5px6
0px 5px rgba506
5px rgba50 506
rgba50 50 506
rgba0 0 06
nonemargin 0px 0px6
nav ul liresponsive-tab6
helvetica sans-seriffont-size 18pxfont-weight6
12pxpadding 6px 0px6
sans-serifmargin 0pxpadding 8px6
15px 8px 15pxtext-align6
0 auto 20pxpadding6
10px 0px 10px6
helvetica sans-seriffont-size 12pxfont-weight6
20pxpadding 4pxwidth 526
auto 20pxpadding 4pxwidth6
8px 15pxtext-align centertext-decoration6
15pxtext-align centertext-decoration none6
0pxoverflow hiddenpadding 10px5
0pxpadding 0pxtext-align left5
myriad pro arial5
boldmargin 0px 0px5
background-color fffborder 1px5
0px 0pxoverflow hiddenpadding5
aluminium alloy sheets5
fffborder 1px solid5
0px 10px 0pxpadding5
rightmargin 0px 0px5
dropdown dd ul5
0px 0pxtext-align left5
langtranslator dropdown dd5
0 0 10px5
0px 7pxbackground-repeat no-repeatcolor4
0px 1px 1px4
872525background-color 872525border-bottom 1px4
dotted dadadafloat nonemargin4
1px dotted dadadafloat4
border-bottom 1px dotted4
303f9ffont-size 18pxfont-weight boldtext-decoration4
0px 12pxtext-decoration none4
000display blockmargin 0pxpadding4
color 000display blockmargin4
nav li li4
0px 12pxtext-decoration underline4
000font-size 12pxpadding 5px4
blockmargin 0pxpadding 0px4
0px 0px 0pxoverflow4
0px 0px 10px4
000font-size 18pxfont-weight boldtext-decoration4
0px 0px 0pxwidth4
color 000font-size 18pxfont-weight4
1px solid nonefloat4
color 303f9ffont-size 18pxfont-weight4
6px 0pxtext-align centerwidth4
ahover -moz-border-radius 5px-webkit-border-radius4
ahover color 000font-size4
000margin 0pxpadding 0px4
0px 1px rgba04
dd ul li4
000font-size 12pxpadding 6px4
0pxpadding 4pxtext-align center4
0pxpadding 0px langtranslator4
langtranslator dropdown dt4
fffborder-bottom 1px solid4
color 000margin 0pxpadding4
nonemargin 0pxoverflow hiddenpadding4
0pxpadding 4pxwidth 224
-moz-transition all 025s4
ui-button-textui-button-text-icons ui-button-textpadding 4em4
all 025s ease-in-out-o-transition4
leftmargin 0pxpadding 4pxwidth4
025s ease-in-out-o-transition all4
ui-tabs-nav liui-tabs-selected acursor4
float nonetext-align center4
call me free4
autoopacity 01pointer-events none4
cursor autoopacity 01pointer-events4
ease-in-out-o-transition all 025s4
all 025s ease-in-out-webkit-transition4
ahover color 000margin4
border solid 1px4
025s ease-in-out-webkit-transition all4
ease-in-out-webkit-transition all 025s4
0pxpadding 0px 0px4
normalfont-weight normaltext-decoration none4
normalmargin 0pxpadding 6px4
0px 1px rgba2554
000font-size 12pxmargin 0pxpadding4
li ahover color4
0pxtext-align leftwidth 270px4
6px 0pxtext-align leftwidth4
0px 0pxpadding 6px4
18pxlist-style-type nonemargin 0px4
leftline-height 18pxlist-style-type nonemargin4
float leftline-height 18pxlist-style-type4
ul float leftline-height4
872525border-bottom 1px solid4
1px solid 303f9fcolor4
color fffffftext-decoration none4
background-color fffborder-bottom 1px4
6px 10px 6pxwidth4
10px 6px 10px4
hiddenpadding 10px 6px4
20px 0pxoverflow hiddenpadding4
0px 20px 0pxoverflow4
0px 0px 20px4
all 025s ease-in-out4
text-decorationnone background4d4d4d padding3px3
padding3px 5px border-radius3px3
background4d4d4d padding3px 5px3
color fffffffont-family arial3
5px langtranslator dropdown3
343434 langtranslator dropdown3
color 343434 langtranslator3
boldtext-align lefttext-decoration none3
img height automax-width3
alloy sheets aluminum3
rgba1 1 13
colorffffff text-decorationnone background4d4d4d3
solid 303f9fcolor 303f9ffont-size3
border-bottom 1px solid3
none importantmargin 03
20px 1px rgba13
font-size 14px font-weight3
font-size 14pxfont-weight normal3
6px 0pxtext-align left3
10px 0pxpadding 6px3
18pxfont-weight boldmargin 0px3
303f9ffont-size 18pxfont-weight boldmargin3
marquee0 table td3
margin 0 03
float none importantmargin3
floatnoneborder-right0width autoheight 175pxborder-bottom3
sans-seriffont-size 14pxfont-weight normalpadding3
303f9fcolor 303f9ffont-size 18pxfont-weight3
autoheight 175pxborder-bottom 1px3
175pxborder-bottom 1px solid3
1px solid 4f2b063
10px 10px 03
fffmargin 0pxpadding 4pxtext-align3
background-color fffmargin 0pxpadding3
regional-lang colorffffff text-decorationnone3
100margin 0px 0px3
0 0padding 03
1px rgba1 13
5px-webkit-border-radius 5pxbackground urlhttpstiimgtistaticcomcatalogstemplate65934enquirybghoverjpg3
1px 20px 1px3
color 000font-size 12pxfont-weight3
float nonemargin 0pxoverflow3
lucida sans unicode3
sans unicode lucida3
unicode lucida grande3
lucida grande sans-seriffont-size3
grande sans-seriffont-size 12pxmargin3
000font-size 12pxfont-weight normalmargin3
boldpadding 5pxtext-align left3
12pxfont-weight normalmargin 0pxpadding3
float rightmargin 0px3
0px 0pxpadding 0pxwidth3
0pxpadding 0pxwidth 743
12pxmargin 0pxpadding 6px3
000display blockfont-size 12pxmargin3
pro arial helvetica3
ahover text-decoration underline3
dadadafloat nonemargin 0px3
0px 0pxtext-align centerwidth3
sans-seriffont-size 18pxfont-weight boldmargin3
roboto arial helvetica3
float rightmargin 03
rightmargin 0 03
roboto arial verdana3
color 000000text-decoration none3
margin 0 23
verdana arial helvetica3
0 2 03
2 0 03
margin 0 automax-width3
bottom 10pxleft 0width3
10pxleft 0width 1003
0px 0pxposition relativewidth3
margin 0pxpadding 0pxtext-align3
blockfont-size 12pxmargin 0pxpadding3
-moz-border-radius 5px-webkit-border-radius 5pxbackground3
1px 1px 20px3
3px 3px 4px3
solid e28300color ffffloat3
0px 0pxpadding 0pxtext-align3
ahover color fffffftext-decoration3
helvetica sans-seriffont-size 11pxfont-weight3
0pxtext-align centerwidth 323
100margin 0pxoverflow hiddenpadding3
3px 4px rgba03
blockpadding 10pxtext-decoration none3
4px rgba0 23
rgba0 2 03
color 000000font-size 12pxtext-decoration3
000000font-size 12pxtext-decoration none3
nonemargin 0padding 03
background urlhttpstiimgtistaticcomcatalogstemplate65934catepng no-repeat3
urlhttpstiimgtistaticcomcatalogstemplate65934catepng no-repeat right3
border 0px solid3
fffdisplay blockpadding 10pxtext-decoration3
5pxbackground urlhttpstiimgtistaticcomcatalogstemplate65934enquirybghoverjpg top3
3px-webkit-border-radius 3pxbackground urlhttpstiimgtistaticcomcatalogstemplate65934enquirybgjpg3
urlhttpstiimgtistaticcomcatalogstemplate65934enquirybghoverjpg top left3
left repeat-xborder-radius 5pxcolor3
repeat-xborder-radius 5pxcolor fffffffont3
5pxcolor fffffffont bold3
fffffffont bold 14px3
-moz-border-radius 3px-webkit-border-radius 3pxbackground3
3pxbackground urlhttpstiimgtistaticcomcatalogstemplate65934enquirybgjpg top3
303f9fcolor fffdisplay blockpadding3
urlhttpstiimgtistaticcomcatalogstemplate65934enquirybgjpg top left3
left repeat-xborder-radius 3pxcolor3
repeat-xborder-radius 3pxcolor ffffffdisplay3
-moz-border-radius 5px-webkit-border-radius 5pxbackground-color3
0pxtext-align centerwidth 1003
ahover background 303f9fcolor3
background 303f9fcolor fffdisplay3
sheets aluminum sheets3
0px 0px104
1px solid61
0 056
helvetica sans-seriffont-size43
0pxpadding 0px33
verdana helvetica28
0px 6px27
arial verdana27
arial helvetica26
6px 0px25
ahover color25
0pxtext-align center24
margin 0pxpadding24
6px 0pxtext-align23
0pxoverflow hiddenpadding22
float nonemargin19
color 000font-size18
0pxpadding 6px18
0px 5px17
0pxtext-align left17
all 025s16
0px 0pxpadding14
0pxpadding 0pxtext-align14
nonemargin 014
1px 1px13
color 000000font-family13
nav ul13
nav li13
margin 013
000000font-family arial13
0px 1px12
centertext-decoration none12
boldtext-decoration none12
0padding 012
hiddenpadding 0px12
langtranslator dropdown12
translate3d0 012
0 auto11
0 0padding11
solid 1px11
ahover background10
0 10px10
0px 10px10
5px 0px10
0px 0pxtext-align10
0px solid10
10px 0px9
0pxtext-align centerwidth9
5px 0pxtext-align9
boldmargin 0px9
dropdown dd9
float leftmargin9
12pxmargin 0pxpadding9
li ahover8
0px 12pxtext-decoration8
12px 0px8
0px 12px8
nonemargin 0px8
000font-size 12pxpadding8
18pxfont-weight boldtext-decoration8
10px 08
float rightmargin8
12pxtext-decoration none7
2 07
border-bottom 1px7
sans-seriffont-size 14pxfont-weight7
0 autopadding7
0text-align center7
hiddenpadding 10px7
centerwidth 1007
303f9ffont-size 18pxfont-weight7
fffffftext-decoration none7
14px arial7
media max-width7
0pxtext-align justify7
helvetica sans-serifmargin7
sans-serifmargin 0pxpadding7
12pxpadding 5px7
ul liresponsive-tab6
background-color fffborder6
18pxfont-weight boldmargin6
roboto arial6
sans-seriffont-size 12pxfont-style6
12pxfont-style normalfont-weight6
ul li6
alloy sheets6
rgba50 506
ul float6
50 506
leftmargin 0pxpadding6
12pxpadding 6px6
aluminium alloy6
5px rgba506
dropdown dt6
0pxpadding 0pxwidth6
sans-seriffont-size 18pxfont-weight6
normalfont-weight normaltext-decoration6
-moz-border-radius 5px-webkit-border-radius6
float nonetext-align6
255 2556
15px 8px6
8px 15px6
0pxpadding 8px6
rightmargin 0px6
0 26
bold 14px6
rgba255 2556
left repeat-xborder-radius6
auto 20pxpadding6
20pxpadding 4pxwidth6
float left6
sans-seriffont-size 12pxfont-weight6
4pxwidth 526
top left6
1px dotted6
img height6
1px rgba2556
15pxtext-align centertext-decoration6
1px rgba06
ui-button-textpadding 4em6
rgba0 06
8px 15pxtext-align6
blockfont-size 12pxmargin6
color 000display5
0width 1005
10px 0pxpadding5
display none5
background 303f9fcolor5
blockmargin 0pxpadding5
nonetext-transform uppercase5
margin 0padding5
normalmargin 0pxpadding5
normaltext-decoration none5
fffborder 1px5
color fffffffont-family5
solid 303f9fcolor5
background-color ffffloat5
0px 0pxoverflow5
ffffloat leftmargin5
myriad pro5
pro arial5
color fffffftext-decoration5
0 importantpadding5
0pxwidth 1005
dd ul5
12px 05
color 000000font-size5
background-color fffborder-bottom5
0px 20px5
call me4
ul list-style-type4
me free4
send inquiry4
15pxfont-weight boldpadding4
10pxtext-decoration none4
ui-datepicker-buttonpane buttonfloat4
segoe uiarialsans-seriffont-size4
liui-tabs-selected acursor4
font-size 14px4
altprolinkcontalt li4
altprolinkcont li4
100background -moz-linear-gradienttop4
872525background-color 872525border-bottom4
872525border-bottom 1px4
5em 5em4
padding3px 5px4
color 303f9ffont-size4
marquee0 table4
9pxheight 9pxleft4
-5pxtop 0height4
nonetext-align center4
float none4
width 924
4em 1emui-button-icon-only4
000font-size 18pxfont-weight4
ui-tabs-nav liui-tabs-selected4
ui-tabs-nav li4
solid nonefloat4
aui-tabs ui-tabs-nav4
nav lihover4
li li4
30px 04
0 15px4
2em 2em4
4pxtext-align center4
5px 5px4
ui-button-textui-button-text-icons ui-button-textpadding4
15px 04
all 07s4
0pxpadding 4pxtext-align4
sheets aluminum4
0px langtranslator4
ahover -moz-border-radius4
0px 04
fffborder-bottom 1px4
color 000margin4
prolinkcontalt li4
leftwidth 270px4
0pxtext-align leftwidth4
0 automax-width4
5pxtext-align left4
2px solid4
nonemargin 0pxoverflow4
font-size 12pxpadding4
leftline-height 18pxlist-style-type4
float leftline-height4
000font-size 12pxmargin4
10px 6pxwidth4
000000text-decoration none4
6px 10px4
10px 6px4
cursor pointerheight4
01pointer-events none4
autoopacity 01pointer-events4
cursor autoopacity4
20px 0pxoverflow4
0pxwidth 744
0text-align left4
-moz-border-radius-topleft 10px-moz-border-radius-topright4
4pxwidth 224
0pxpadding 4pxwidth4
100width 1004
centerwidth auto4
18pxlist-style-type nonemargin4
000margin 0pxpadding4
025s ease-in-out-o-transition4
0pxpadding 4px4
color 025885text-decoration4
verdana arial4
searchbutton2 padding4
0px 0pxwidth4
prolinkcont li4
dotted dadadafloat4
7pxbackground-repeat no-repeatcolor4
0px 7pxbackground-repeat4
-moz-transition all4
dadadafloat nonemargin4
ease-in-out-o-transition all4
li background-image4
025s ease-in-out-webkit-transition4
12pxtext-decoration underline4
0padding 0text-align4
000display blockmargin4
border solid4
fffffffont-family arial4
025s ease-in-out4
ease-in-out-webkit-transition all4
swiper-pagination-bullet-active background3
table td3
14px font-weight3
background fff3
14pxfont-weight normal3
font-size 14pxfont-weight3
border-bottom 0px3
ffffloat rightmargin3
sans-seriffont-size 15pxfont-weight3
0px 0pxposition3
bottom 10pxleft3
sddm div3
1px 03
10pxleft 0width3
0pxtext-align centertext-transform3
0pxposition relativewidth3
303f9fcolor 303f9ffont-size3
html catnamehead3
color a5a7b3font-family3
background-color 303f9fcolor3
ffffffdisplay blockfloat3
5px-webkit-border-radius 5pxbackground3
normalpadding 8px3
rightmargin 0padding3
text-decorationnone background4d4d4d3
ingots aluminium3
aluminum sheets3
pronextprodmaincontainer float3
sheets aluminium3
boldmargin 0pxpadding3
h1 color3
rightmargin 03
0 5px3
14pxfont-weight boldline-height3
color 000000text-decoration3
color 000text-decoration3
color 000font-weight3
5px border-radius3px3
background4d4d4d padding3px3
colorffffff text-decorationnone3
tiservices float3
floatnoneborder-right0width autoheight3
none importantmargin3
importantmargin 03
importantpadding 03
float nonepadding3
center nav3
nextandbigimgcontainer margin-right3
autoheight 175pxborder-bottom3
regional-lang colorffffff3
175pxborder-bottom 1px3
solid 4f2b063
5px 03
ahover text-decoration3
10px 10px3
background ffffffborder3
rightprod li3
5px langtranslator3
fffmargin 0pxpadding3
3px 3px3
sans-seriffont-size 11pxfont-weight3
none ourproducts3
float leftheight3
centerwidth 323
rightheight 100margin3
100margin 0pxoverflow3
3px 4px3
solid e28300color3
4px rgba03
rgba0 23
000000font-size 12pxtext-decoration3
nonemargin 0padding3
12pxfont-weight normalmargin3
ul display3
li ul3
e28300color ffffloat3
border 0px3
000font-size 12pxfont-weight3
3pxbackground urlhttpstiimgtistaticcomcatalogstemplate65934enquirybgjpg3
urlhttpstiimgtistaticcomcatalogstemplate65934enquirybghoverjpg top3
repeat-xborder-radius 5pxcolor3
5pxcolor fffffffont3
fffffffont bold3
000display blockfont-size3
-moz-border-radius 3px-webkit-border-radius3
3px-webkit-border-radius 3pxbackground3
urlhttpstiimgtistaticcomcatalogstemplate65934enquirybgjpg top3
blockpadding 10pxtext-decoration3
repeat-xborder-radius 3pxcolor3
3pxcolor ffffffdisplay3
5px-webkit-border-radius 5pxbackground-color3
centertext-decoration nonewidth3
solid cacacacolor3
303f9fcolor fffdisplay3
fffdisplay blockpadding3
none nav3
ul background3
background-color fffmargin3
none readmore3
none langtranslator3
sans unicode3
lucida sans3
color 3434343
343434 langtranslator3
5pxbackground urlhttpstiimgtistaticcomcatalogstemplate65934enquirybghoverjpg3
boldpadding 5pxtext-align3
avisited color3
lucida grande3
height automax-width3
text-decoration underline3
20px 03
14pxfont-weight normalpadding3
footer ul3
100margin 0px3
0pxwidth 663
unicode lucida3
grande sans-seriffont-size3
background urlhttpstiimgtistaticcomcatalogstemplate65934catepng3
1px rgba13
urlhttpstiimgtistaticcomcatalogstemplate65934catepng no-repeat3
no-repeat right3
0 20px3
background ffffloat3
sans-seriffont-size 12pxmargin3
1px 20px3
20px 1px3
rgba1 13
lefttext-decoration none3
1 13
20pxwidth 1003
logomain float3
float leftpadding3
10pxtext-align left3
12pxfont-weight boldtext-align3
boldtext-align lefttext-decoration3
slidesperview 33
0px293
0272
color137
1px121
none100
0pxpadding98
solid91
float89
10px70
0pxtext-align69
6px65
background55
helvetica54
arial54
li51
center51
5px49
margin49
left49
sans-seriffont-size47
ahover46
0padding46
nonemargin43
139
ul39
background-color38
nav35
verdana32
auto31
-16px30
-80px30
-32px30
-64px30
-48px30
hiddenpadding29
-96px26
all25
html24
aluminium24
-112px24
0pxoverflow22
-128px22
-144px22
display22
20px21
12px21
8px21
centerwidth21
5em20
0pxwidth20
000font-size20
dropdown20
width19
boldmargin19
leftmargin19
langtranslator18
rightmargin18
15px18
2em18
025s18
18pxfont-weight18
centertext-decoration17
important17
font-size17
0width17
img17
4em16
4px16
ui-tabs-nav16
underline16
padding15
border15
12pxmargin15
14pxfont-weight15
height15
aluminum15
products15
-160px14
0text-align14
000000font-family14
ffffloat14
-176px14
sheets14
12pxpadding13
14px13
12pxfont-weight13
leftwidth13
213
absolutetop13
303f9fcolor13
boldtext-decoration13
312
412
1em12
512
-208px12
-192px12
translate3d012
12pxtext-decoration11
leftheight11
boldpadding11
our11
cursor11
border-bottom11
text-aligncenter11
displaynone11
-moz-border-radius11
background-image10
dd10
blockfont-size10
max-width10
rgba010
top10
normalmargin10
4pxwidth10
-224px10
-240px10
20pxpadding10
justify10
fffdisplay9
5pxcolor9
5pxtext-align9
media9
nonefloat9
bold9
alloy9
blockmargin9
td8
width1008
3px8
-5pxtop8
right8
true8
absolutez-index8
roboto8
var8
autopadding8
blockpadding8
ui-datepicker-buttonpane8
68
15pxtext-align8
15pxfont-weight8
fffffftext-decoration8
ui-button-textpadding8
autoui-datepicker-rtl8
normalpadding8
1pxui-datepicker8
0ui-datepicker8
78
altprolinkcont7
nonewidth7
prolinkcont7
importantpadding7
0pxposition7
ffffffdisplay7
303f9ffont-size7
normaltext-decoration7
sans-serifmargin7
nonetext-transform7
3pxcolor7
send7
nonefont-size7
100margin7
footer7
000display7
catnamehead7
automax-width7
swiper-slide7
dt7
2px7
0height6
50margin-top6
9pxheight6
more6
ui-accordion-header6
lucida6
productbigimgcontainer6
ui-menu-item6
86
rgba506
sddm6
dotted6
widthauto6
relativepadding6
rgba2556
96
uppercase6
nonetext-align6
visiontxt6
10pxtext-align6
prolinkcontalt6
normalfont-weight6
12pxfont-style6
border-right6
marquee06
fffborder6
spacebetween6
lihover6
ui-datepicker-groupwidth6
acolor6
spandisplay6
rightprod6
nonepadding6
footerlinks6
altprolinkcontalt6
blockfloat6
fffffffont-family6
700color6
leftline-height6
liresponsive-tab6
absoluteright6
boldtext-align6
relativewidth6
5px-webkit-border-radius6
2width6
repeat-xborder-radius6
000margin5
nextandbigimgcontainer5
105
115
rightheight5
blockposition5
parabox5
slidesperview5
000000font-size5
robotofont-size5
autooverflow5
btncont5
function5
contact5
pro5
myriad5
10pxpadding5
11px5
coil5
relativetext-align5
-moz-transition5
contactdetail5
div5
contactheading5
h25
absolutewidth5
pronextprodmaincontainer5
table5
we5
fffborder-bottom5
-moz-box-sizing5
fff5
altprodcatname5
6pxwidth5
normal5
10pxtext-decoration5
leftpadding5
swiper-pagination-bullet5
lefttext-decoration5
bottom5
872525border-bottom4
altcateprodimgcont4
124
backlink4
872525background-color4
-moz-linear-gradienttop4
100background4
16px4
134
altcatnamehead4
sendemailtext4
cateproddescrcont4
altotherprodmaincon4
boxreadmore4
100filter4
4pxtext-align4
altprodimgcont4
altprodimgconthover4
coname4
cateprodimgcont4
altprodcatdescr4
1emui-button-icon-only4
cmftext4
buttonfloat4
aui-tabs4
liui-tabs-selected4
acursor4
noneui-datepicker4
2pxui-datepicker4
tablewidth4
100font-size4
7em4
2emtext-align4
ui-datepicker-group-last4
0ui-tabs4
ui-datepicker-group-middle4
ui-datepicker-buttonpaneclear4
rightui-datepicker-rtl4
call4
me4
free4
inquiry4
ingots4
industrial4
clients4
0border-bottom4
-3emmargin-left4
font-weight4
-5pxleft4
colorffffff4
padding3px4
segoe4
uiarialsans-seriffont-size4
avisitedcolor4
aui-widget-content4
ui-state-highlight4
aui-widget-header4
ui-state-error4
7pxwidth4
9pxleft4
ui-dialog-buttonpane4
1ui-accordion4
ui-iconposition4
absoluteleft4
relativetop4
nonedisplay4
0margin-right4
1emtext-decoration4
ui-button-textui-button-text-icons4
50margin-left4
0ui-dialog4
enquirybtn4
new4
prodcatname4
-moz-box-shadow4
tiservices4
30px4
no-repeat4
importantwidth4
productgallerybg4
20pxmargin4
-webkit-transition4
100z-index4
100width4
span4
list-style-type4
blockfont-weight4
otherprodmaincon4
automargin4
autoopacity4
01pointer-events4
pointerheight4
readmore4
rotateimgtxt4
searchbutton24
previous4
centertext-transform4
proname4
maintext4
sendinquary4
viewall4
ease-in-out4
importantmargin4
proddescription4
000000display4
18pxlist-style-type4
270px4
07s4
7pxbackground-repeat4
no-repeatcolor4
dadadafloat4
ease-in-out-o-transition4
imgdisplay4
10pxborder-top-right-radius4
025885text-decoration4
ease-in-out-webkit-transition4
10px-webkit-border-top-right-radius4
000000text-decoration4
144
0position4
logomain4
logo4
-moz-border-radius-topleft4
viewmore4
10px-moz-border-radius-topright4
rightfont-family3
2pxmargin3
punchline3
prodimgconthover3
prodimgcont3
border-top3
text-decoration3
0overflow3
fffffffloat3
pointerfloat3
unicode3
grande3
sans3
firstul3
secondul3
ffffffborder3
header3
scroll3
range3
false3
us3
h13
b3
ff6405color3
ffftext-decoration3
calltoactionbuttons23
boldline-height3
viewallpro3
000text-decoration3
000font-weight3
nonecolor3
sendinq3
swiper-pagination3
ffffff3
socialiconright3
a5a7b3font-family3
swiper-button-next3
swiper-button-prev3
proddescrcont3
0003
30pxpadding3
10pxleft3
swiper-pagination-bullet-active3
50px3
hidden3
title3
topbar3
swiper-container-autoheight3
proinquirybtn3
153
matterpart3
no-repeatborder3
altcateproddescrcont3
altcateprodcont3
rgba13
03s3
getaquote3
urlhttpstiimgtistaticcomcatalogstemplate65934catepng3
20pxwidth3
noneborder3
d56e303
next3
otherprohead13
search3
50width3
163
altenquirybtn3
altprolink3
gacreate3
fffmargin3
173
2pxleft3
hpproduct3
imagepart3
imagepart23
183
193
innerbanner3
background-repeat3
avisited3
ffffffcolor3
blockline-height3
203
languagenone3
altproddescription3
leftoverflow3
bg3
pageview3
6pxtext-align3
urlhttpstiimgtistaticcomcatalogstemplate65934enquirybgjpg3
show3
regional-lang3
text-decorationnone3
background4d4d4d3
border-radius3px3
ffffont-weight3
5pxbackground-color3
3pxbackground3
4f2b063
3px-webkit-border-radius3
fffffffont3
urlhttpstiimgtistaticcomcatalogstemplate65934enquirybghoverjpg3
5pxbackground3
headerright3
prolink3
prodcatdescr3
cacacacolor3
175pxborder-bottom3
ourproducts3
e28300color3
0text-decoration3
11pxfont-weight3
padding03
ourproductstag3
phone3
0display3
22pxmargin3
213
autoheight3
autowidth3
19pxmargin3
border03
proname23
margin-right3
100border3
floatnoneborder-right0width3
prodescriptioncontainer3

Maxalimpex.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Maxalimpex.net is a scam?

Websites with Similar Names

Maxal.com
Untitled Document
Maxala.org
Махалля - вся правда об Узбекистане!
Maxalbums.com
MAXALBUMS.COM :: FULL MP3 ALBUMS DOWNLOAD
Maxalbums.me
MAXALBUMS.ME
Maxalbums.top
maxalbums.top
Maxalconstruction.com
MAXIMAL CONSTRUCTION
Maxalertnow.com
Home - MaxAlertNow
Maxalesandprovisions.com
Craft Brewery, Homebrew Supplies - Max Ales & Provisions - Mesa, Az
Maxalimpex.net
Alloy Sheets Supplier in Mumbai,Aluminium Alloy Sheets Manufacturer India,Maharashtra
Maxalis.com
HugeDomains.com - Shop for over 300,000 Premium Domains

Recently Updated Websites

Neemarjewels.com 2 seconds ago.Asc-pr.com 2 seconds ago.Activeboosters.com 3 seconds ago.Siggl.com 3 seconds ago.Gladtidingspreschool.com 3 seconds ago.Todosconpr.org 4 seconds ago.Noleggioautocarservice.com 4 seconds ago.Stoneimpressions.com 4 seconds ago.Garten-haus-hof.com 5 seconds ago.Kettravel.com 5 seconds ago.Nbhooks.com 6 seconds ago.Paverdudes.com 6 seconds ago.Rmdemella.com 7 seconds ago.Stoneinnovations.net 7 seconds ago.Fantasyfootballtoolbox.com 7 seconds ago.Revitalhnmembers.com 8 seconds ago.Mystudiocrm.com 8 seconds ago.Carpetsites.com 8 seconds ago.P-dit.com 8 seconds ago.Abio.org 9 seconds ago.Good-ness.com 9 seconds ago.Sjxin.com 9 seconds ago.Jantravels.com 10 seconds ago.Joyride-studios.com 10 seconds ago.Stevelacey.net 10 seconds ago.Chelsealinwallace.com 11 seconds ago.Vuniforms.com 11 seconds ago.Sinditaxisp.org.br 11 seconds ago.Hunkarmedikal.com 11 seconds ago.Warrencoveoysters.com 12 seconds ago.