Maxtrader.de  |  Home - MAX Trader
Low trust score  | 
Als Direktimporteur bieten wir qualitativ hochwertige Uhren sowie Outdoorartikel wie Zelte, Rucksäcke und Schlafsäcke zu extrem günstigen Preisen an.

Maxtrader.de Website Information

Maxtrader.de has a Low Trust Score, a Statvoo Rank of G, an Alexa Rank of 336,573, a Majestic Rank of 0, a Domain Authority of 37% and is not listed in DMOZ.

Maxtrader.de is hosted by Hetzner Online GmbH in Sachsen, Falkenstein, Germany, 08223.
Maxtrader.de has an IP Address of 78.46.8.140 and a hostname of dedi1740.your-server.de.

The domain maxtrader.de was registered 201 decades 8 years 11 months ago by , it was last modified 6 years 9 months 4 days ago and currently is set to expire 201 decades 8 years 11 months ago.


Whois information for maxtrader.de

Full Whois Lookup for Maxtrader.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: maxtrader.de
Nserver: ns21.schlund.de
Nserver: ns22.schlund.de
Status: connect
Changed: 2013-02-15T16:51:50+01:00

[Tech-C]
Type: ROLE
Name: Hostmaster EINSUNDEINS
Organisation: 1&1 Internet AG
Address: Brauerstr. 48
PostalCode: 76135
City: Karlsruhe
CountryCode: DE
Phone: +49.7219600
Fax: +49.72191374248
Email: Login to show email
2012-12-10T20:50:22+01:00

[Zone-C]
Type: ROLE
Name: Hostmaster EINSUNDEINS
Organisation: 1&1 Internet AG
Address: Brauerstr. 48
PostalCode: 76135
City: Karlsruhe
CountryCode: DE
Phone: +49.7219600
Fax: +49.72191374248
Email: Login to show email
2012-12-10T20:50:22+01:00

Who hosts Maxtrader.de?

Maxtrader.de Web Server Information

Hosted IP Address:78.46.8.140
Hosted Hostname:dedi1740.your-server.de
Service Provider:Hetzner Online GmbH
Hosted Country:GermanyDE
Location Latitude:50.4779
Location Longitude:12.3713
Webserver Software:Not Applicable

HTTP Header Analysis for Maxtrader.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 26 Aug 2015 09:35:02 GMT
Server: Apache
X-Powered-By: PHP/5.3.29
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Expires: Fri, 06 Jun 1975 15:10:00 GMT
Vary: User-Agent
Last-Modified: Wed, 26 Aug 2015 09:35:02 GMT
Transfer-Encoding: chunked
Content-Type: text/html; charset=utf-8


Need to find out who hosts Maxtrader.de?

Maxtrader.de Free SEO Report

Website Inpage Analysis for Maxtrader.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Maxtrader.de

addelemblaupersonen blau uvpoutdoorfacebooknbsp nbspesesfitnesstunnelzelturltstwitter0 0familienzelt skandikapersonendatatunnelzelt skandikadede1uvpgadgetelementotherbuttonsfunctionreplacevariantsregiongfoldervareventpersonen blautargeturl gaqpushtracksocial facebookfunction targeturl gaqpushtracksocialgclassnameparamsgaqpushtracksocialready functiontargeturltruefalsereadytargeturl gaqpushtracksocialcustomifparagraphfamilienzeltnonefunction varfunction eventfrfrcreategadgets5 personenblau uvpdeluxenbspclassbuttoncontainscustom variantsampskandikagadgetsgaqpushtracksocial facebookcampingstuhl0function targeturldiv

Longtail Keyword Density for Maxtrader.de

KeywordsOccurences
targeturl gaqpushtracksocial facebook3
function targeturl gaqpushtracksocial3
personen blau uvp3
0 07
blau uvp4
function event4
familienzelt skandika4
ready function4
targeturl gaqpushtracksocial3
gaqpushtracksocial facebook3
custom variants3
function targeturl3
5 personen3
tunnelzelt skandika3
personen blau3
nbsp nbsp3
function var3
skandika20
uvp20
function18
018
nbsp17
var16
if12
personen8
facebook7
targeturl7
false6
gaqpushtracksocial6
twitter6
true6
custom5
event5
elem5
eses4
add4
dede4
otherbuttons4
blau4
ready4
amp4
familienzelt4
data4
deluxe4
variants4
classbutton3
ts3
params3
url3
region3
frfr3
gfolder3
tunnelzelt3
13
none3
div3
fitness3
outdoor3
campingstuhl3
creategadgets3
gadget-element3
replace3
contains3
paragraph3
gclassname3
gadgets3

What are the nameservers for maxtrader.de?

Maxtrader.de Domain Nameserver Information

HostIP AddressCountry
ns21.schlund.de 217.160.80.143Germany Germany
ns22.schlund.de 217.160.81.143Germany Germany

Maxtrader.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Maxtrader.de is a scam?