Mediaset.it Website Analysis Summary

Mediaset.it  |  Mediaset.it: Intrattenimento, news, sport con una struttura che propone video, foto e articoli. Con le sezione Canale 5, Rete 4, Italia 1, Mediaset Premium, Premium Cinema, Iris, Boing, Mya, Joy, Steel
High trust score  | 
Mediaset Play: Programmi TV, Video, Dirette Live e Film | Mediaset Play


Rank
2,391
Rating
B
Trust Score
High trust score
Estimated worth
$6,757,560
Estimated daily income
$6,257
Estimated monthly income
$190,317
Backlinks
0

Mediaset.it has a High trust score, and a Statvoo Rank of B.

Mediaset.it is hosted by Videotime SPA in Italy.
Mediaset.it has an IP Address of 91.211.156.128 and a hostname of 91.211.156.128.

The domain mediaset.it was registered 201 decades 9 years 4 months ago by IT-Nic, it was last modified 201 decades 9 years 4 months ago and currently is set to expire 4 years 2 months 2 days ago.

It is the world's 2,391 most popular site among over 300 million websites.

Mediaset.it has a total of 0 backlinks.

Mediaset.it gets approximately 782,100 unique visitors a day and 6,256,800 pageviews per day.

Mediaset.it has an estimated worth of $6,757,560.
An average daily income of approximately $6,257, which is wroughly $190,317 per month.

Whois information for mediaset.it

Full Whois Lookup for Mediaset.it Whois Lookup

*********************************************************************
* Please note that the following result could be a subgroup of *
* the data contained in the database. *
* *
* Additional information can be visualized at: *
* http://www.nic.it/cgi-bin/Whois/whois.cgi *
*********************************************************************

Domain: mediaset.it
Status: ok
Created: 1996-02-27 00:00:00
Last Update: 2016-12-30 00:38:21
Expire Date: 2017-12-14

Registrant
Organization: Mediaset S.p.A.
Address: Via Pietro Paleocapa, 3
Milano
20121
MI
IT
Created: 2011-08-03 10:46:37
Last Update: 2011-08-03 10:46:37

Admin Contact
Name: Fedele Confalonieri
Organization: Mediaset S.p.A.
Address: Via Pietro Paleocapa, 3
Milano
20121
Mi
IT
Created: 2011-08-03 10:49:47
Last Update: 2011-08-03 10:49:47

Technical Contacts
Name: Domain Name Management Service
Organization: BT Italia S.p.A.
Address: BT Italia S.p.A.
Roma
00142
RM
IT
Created: 2007-04-03 13:16:14
Last Update: 2011-11-21 10:33:35

Registrar
Organization: BT Italia s.p.a.
Name: BTITALIA-REG
Web: http://www.btitalia.it

Nameservers
ns1.rti.it
ulisse.albacom.net
ns2.rti.it

Who hosts Mediaset.it?

Mediaset.it Web Server Information

Hosted IP Address:91.211.156.128
Hosted Hostname:91.211.156.128
Service Provider:Videotime SPA
Hosted Country:ItalyIT
Location Latitude:43.1479
Location Longitude:12.1097
Webserver Software:Not Applicable

HTTP Header Analysis for Mediaset.it

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Fri, 22 May 2015 15:46:22 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=10
Vary: Accept-Encoding,User-Agent
Sid: c0-f90a3e02-m01-001
Expires: Fri, 22 May 2015 15:46:22 GMT
Cache-Control: public
Content-Encoding: gzip

Need to find out who hosts Mediaset.it?

Mediaset.it Free SEO Report

Website Inpage Analysis for Mediaset.it

H1 Headings:0
H2 Headings:5
Il videogame di Barbara Alberti
Dirette
Film della settimana
Stasera in tv
Rivedi la TV
H3 Headings:119
Striscia la notizia
New Amsterdam 2
Grande Fratello VIP
Verissimo
Grande Fratello VIP
Cine34
Verissimo
Grande Fratello VIP
Verissimo
Grande Fratello VIP
Grande Fratello VIP
Grande Fratello VIP
Grande Fratello VIP
Grande Fratello VIP
Grande Fratello VIP
Grande Fratello VIP
Grande Fratello VIP
Grande Fratello VIP
Grande Fratello VIP
Grande Fratello VIP
Grande Fratello VIP
Grande Fratello VIP
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
Verissimo
La prima cosa bella
Rosamunde Pilcher: inaspettato come il destino
Inga Lindstrom - L'aquilone
Dopo mezzanotte
La teta y la luna
Io e te
L'immagine del desiderio
Sole a catinelle
Act of valor
Trio | Alla ricerca del tesoro miracoloso
The burning plain - Il confine della solitudine
Il piccolo principe
Nella morsa del ragno
Dragon Ball Z: La battaglia degli Dei
Giustizia privata
...E se domani
Lara Croft: Tomb Raider - La culla della vita
Io no spik inglish
Horror movie
Tutto molto bello
Lara Croft: Tomb raider
Safe
Ruby Red III - Verde smeraldo
Un piano perfetto
SportMediaset
SportMediaset
SportMediaset
SportMediaset
SportMediaset
SportMediaset
SportMediaset
SportMediaset
SportMediaset
SportMediaset
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Striscia la notizia
Play Cult
Play Cult
Play Cult
Play Cult
Play Cult
Play Cult
Play Cult
Play Cult
Play Cult
Play Cult
Play Cult
Play Cult
Play Cult
Play Cult
Play Cult
H4 Headings:95
L'aggressione a Brumotti e alla sua troupe a Monza
New Amsterdam: nella stagione precedente
La nuova edizione del "TGF"
Barbara d'Urso: l'intervista a Verissimo in 100 secondi
La sit com "Toraldo"
Cine34 nasce nel giorno in cui Federico Fellini compirebbe 100 anni!
Pierfrancesco Favino: "Il mio amore per Anna"
Una doccia "caliente" per Ivan Gonzalez
Michela Quattrociocche e Alberto Aquilani: la gelosia tra di noi
Elisa De Panicis e la doccia... super hot!
Barbara Alberti: "Io eliminerei subito Pasquale"
Benvenuti alla lavanderia Pugliese
Tutti in forma con Michele Cucuzza
Paola Di Benedetto: "Sei un fan di Benji e Fede?"
Un abbraccio per Carlotta Maggiorana
La sit com "Toraldo"
Fernanda Lessa: "Il mio è un amore da favola"
Barbara Alberti: sono più gravi le corna fisiche o quelle spirituali?
La monogamia secondo Aristide Malnati
Barbara Alberti: "Vi ringrazio per il rispetto nei miei confronti"
La proposta "bizzarra" di Antonella Elia
Antonio Zequila vuole una risposta da Elisa De Panicis
Katia Ricciarelli: l'intervista integrale
Pierfrancesco Favino: l'intervista integrale
Michela Quattrociocche e Alberto Aquilani: l'intervista integrale
Barbara d'Urso: l'intervista integrale
Filippo Magnini e Giorgia Palmas: l'intervista integrale
Rita Rusic: l'intervista integrale
Pupo e Wanda Nara: l'intervista integrale
Paolo Ruffini: l'intervista integrale
Aida Yespica: l'intervista integrale
Alessandra Amoroso: l'intervista integrale
Federica Panicucci e Marco Bacini: l'intervista integrale
Nicoletta Mantovani: l'intervista integrale
Enrico Mentana: l'intervista integrale
Fiorello: l'intervista integrale
Pago: l'intervista integrale
Juliana Moreira e Edoardo Stoppa: l'intervista integrale
Loredana Bertè: l'intervista integrale
Michelle Hunziker: l'intervista integrale
Stefano Accorsi e Edoardo Leo: l'intervista integrale
Ilaria D'Amico: l'intervista integrale
Costanza Caracciolo: l'intervista integrale
Daniele Bossari: l'intervista integrale
Luca Barbareschi e Lucrezia Lante della Rovere: l'intervista integrale
Francesco Scianna: l'intervista integrale
Serie A, Parma-Lecce 2-0, gli highlights
Roma-Juventus 1-2: highlights
Serie A, Verona-Genoa 2-1: gli highlights
Serie A, Torino-Bologna 1-0, gli highlights
Serie A, Fiorentina-Spal 1-0, gli highlights
Serie A, Udinese-Sassuolo 3-0, gli highlights
Serie A, Inter-Atalanta 1-1: gli highlights
Serie A, Lazio-Napoli 1-0, gli highlights
Serie A, Cagliari-Milan 0-2, gli highlights
Serie A, Napoli-Inter 1-3 gli highlights
Striscioni da vetta
Tapiro d'oro a Gennaro Gattuso
L'aggressione a Brumotti e alla sua troupe a Monza
Mara Venier e l'appello per l'Australia
Le felpe di Salvini
Le dichiarazioni shock di Salvo al GF Vip
Modi di dire e citazioni sbagliate
Terremotati napoletani dimenticati
Sosia politico-calcistico
Danza del cabaret
Borseggiatori a Venezia e come riconoscerli
Salvini senza laurea
Striscia tra poco
Brumotti racconta l'aggressione subita a Monza
La mise di Nozzolino
L'ascensore del Castello di Manfredonia
Donald Trump instabile mentalmente?
Palma da record a Padova
Posti letto per i senzatetto a Roma
Come combattere gli sprechi di cibo
Apparizioni e sparizioni sulla neve
False promesse di recupero crediti
Striscia tra poco
Le follie di Mario Giordano
La prima apparizione di Frengo a Mai dire Gol
Michelle Hunziker conduce la sua prima puntata di Colpo di fulmine
La prima apparizione dei Litfiba a Festivalbar
La prima apparizione di Luciana Litizzetto nei panni di "Minchia Sabbry"
Il debutto di Ambra con il gioco dello zainetto
Paolo Bonolis presenta la prima puntata della seconda stagione di Non è la Rai
La prima volta di Carcarlo Pravettoni a Mai dire Gol
Francesca spiega per la prima volta il gioco della metamorfosi
Natalino Balasso nel duo Peli Superflui a Cabaret per una notte 1986
Maurizio Crozza imita per la prima volta Arrigo Sacchi
La prima puntata puntata di Fuego: Alessia Marcuzzi intervista Pippo Baudo
La prima volta del Conte Uguccione a Mai dire Gol
Walter Nudo conduce per la prima volta Colpo di fulmine
La prima volta di Claudio Lippi a Mai Dire Gol
Il Mago Oronzo per la prima volta nello studio di Mai dire gol
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:214
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Mediaset.it

1vtrafficlightdidaysplitidchnew dateitaliadaysplit 1diretta 2110ifi0undaymatchesdatespanday2efunctionguarda la direttacatcherguardaiddayslidestoshownewdbglastweektryilsegui la direttalastweekdirettaelsevarvtrafficdescfunctionisegui

Longtail Keyword Density for Mediaset.it

KeywordsOccurences
segui la diretta3
guarda la diretta3
daysplit 14
new date3
diretta 21103
var22
day8
diretta7
slidestoshow7
daysplit6
lastweek6
idday5
else5
05
e5
14
il4
try4
catcher4
new4
un4
date3
ifi3
vtrafficdesc3
vtrafficlight3
spanday3
idch3
italia3
guarda3
di3
23
segui3
functioni3
dbglastweek3
function3
matches3

What are the nameservers for mediaset.it?

Mediaset.it Domain Nameserver Information

HostIP AddressCountry
ns1.rti.it 91.211.157.129Italy Italy
ulisse.albacom.net 212.17.199.197Italy Italy
ns2.rti.it 91.211.157.130Italy Italy