The Draft, Draft Registration, Draft Resistance, and "Selective Service"

Safety: Low trust score
Year Founded: 2004
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-31
Category: This site has not been categorized yet

Draft Registration, Draft Resistance, and Selective Service


Domain summary

Domain label
medicaldraft
Domain extension
info
Domain registered:
2004-10-20
Domain updated:
2020-10-31
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is medicaldraft.info ranked relative to other sites:

Percentage of visits to medicaldraft.info from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Medicaldraft.info registered?
A: Medicaldraft.info was registered 16 years, 4 months, 2 weeks, 20 hours, 25 minutes, 3 seconds ago on Wednesday, October 20, 2004.
Q: When was the WHOIS for Medicaldraft.info last updated?
A: The WHOIS entry was last updated 4 months, 3 days, 20 hours, 25 minutes, 3 seconds ago on Saturday, October 31, 2020.
Q: What are Medicaldraft.info's nameservers?
A: DNS for Medicaldraft.info is provided by the following nameservers:
  • nirvana.easydns.net
  • rush.easydns.com
  • motorhead.easydns.org
Q: Who is the registrar for the Medicaldraft.info domain?
A: The domain has been registered at Afilias Global Registry Services.
Q: What is the traffic rank for Medicaldraft.info?
A: Medicaldraft.info has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Medicaldraft.info each day?
A: Medicaldraft.info receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Medicaldraft.info resolve to?
A: Medicaldraft.info resolves to the IPv4 address 64.68.200.46.
Q: In what country are Medicaldraft.info servers located in?
A: Medicaldraft.info has servers located in the Canada.
Q: What webserver software does Medicaldraft.info use?
A: Medicaldraft.info is powered by Nginx webserver.
Q: Who hosts Medicaldraft.info?
A: Medicaldraft.info is hosted by easyDNS Technologies, Inc. in Canada.
Q: How much is Medicaldraft.info worth?
A: Medicaldraft.info has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Medicaldraft.info Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Medicaldraft.info Free SEO Report

Website Inpage Analysis for Medicaldraft.info

H1 Headings

1 :
  1. Health Care Workers and the Medical Draft

H2 Headings

0 :

H3 Headings

11 :
  1. Resisters.info | MedicalDraft.info | NationalService.info
  2. Latest updates (subscribe to e-mail updates)
  3. www.MedicalDraft.info
  4. Will There Be A Draft of Health Care Workers?
  5. Who Will Be Drafted?
  6. What Can I Do If I Don't Want to Be Drafted?
  7. What Can We Do Now?
  8. FAQ | What to do? | Women | Lawsuits | Legislation | Newsletter
  9. Home | About | Leaflets | Posters | Links | Organizations & Actions
  10. Resisters.info | NationalService.info | MedicalDraft.info | Hasbrouck.org
  11. Subscribe to e-mail updates about the draft, draft registration, and draft resistance.

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

39:

Links - Internal (nofollow)

0:

Links - Outbound

48:

Links - Outbound (nofollow)

0:

Keyword Cloud for Medicaldraft.info

doctorslikely219901991 gulfpreventmedical caresoldiersnow ifreportarmedtechnicianshcpdssaidavoidmedicinewethey canresistphysicianhadinductioncouldprevent the draftphysicalwantservicemightpublicselective service systemincludetakemythereevenintothink1carehopeduringhave beencosdraftedregistrationmoreyou dont wantmiddleduring the 19901991includingagegulfthanjoinifpersonnel delivery systemif you dontdont wantdo nowspecialistsnothealthneedscare workerscare personnelgeneral draftservice systemdeliverysurgeonsarmed forcescould be draftedpersonnelmostmakemilitaryspecialdutydrafttimestartpercentfewsupportoath19901991 gulf warotherdefermentnational emergencynowactive dutyother medicalnationalusdontdraft youyoullwontsincewouldpublishedtherapyreservistshealth care workerscongress couldwar19901991theyhealth care personnelwars20 throughdoctorenvironmentalbutleavequalifynurseswomendeploymentmedical draftyou couldhasregulationslifelastjustsuchfiscalyourpresidentbeingnewallgulf warif youdeferment or exemptionthemmiddle eastphysiciansjournalcare personnel delivery0civilianalliedbeenfiscal yearyou canonlyworkersdelivery systemactiveyourepeopleexercisegetselectiveif theymedicalprobablyagainstyoung3ordersforcessurgerynursingsaysdostudentsprofessioncancasualtiespastplantheiryou donthealth carenofightplansemergencyregisteruphavewhichyearamericancongressthoseservedo ifselective serviceprofessionalstandbyresistanceyoupersonnel deliveryreadytrainedgeneralmanythroughlicensingarmyessentialoneeastweresystemoperationfirstsomenow if youanyexemptionama

Longtail Keyword Density for Medicaldraft.info

KeywordsOccurences
health care workers14
selective service system6
if you dont4
you dont want4
during the 1990-19914
1990-1991 gulf war4
health care personnel4
now if you3
care personnel delivery3
personnel delivery system3
prevent the draft3
could be drafted3
deferment or exemption3
health care22
selective service17
care workers14
if you11
medical draft8
service system6
dont want5
you can5
general draft4
care personnel4
gulf war4
active duty4
1990-1991 gulf4
you could4
you dont4
armed forces3
medical care3
if they3
do if3
congress could3
other medical3
fiscal year3
personnel delivery3
delivery system3
they can3
20 through3
draft you3
have been3
national emergency3
do now3
now if3
middle east3
draft51
medical40
care28
you28
health26
if23
service21
military19
drafted19
could17
selective17
they16
workers16
have14
congress14
your14
can14
but13
would13
--11
other11
any11
system11
now11
not10
personnel10
do10
us9
people8
dont8
wars7
up7
been7
gulf7
general7
want7
war7
hcpds6
probably6
just6
plans6
those6
most6
many6
likely6
such6
there6
some6
has6
only6
youre6
therapy5
surgery5
we5
first5
take5
registration5
get5
than5
them5
nursing5
think5
duty5
active5
national5
during5
no5
my5
were5
physician5
forces4
young4
environmental4
prevent4
had4
nurses4
operation4
doctors4
against4
being4
regulations4
exercise4
more4
resistance4
all4
report4
induction4
civilian4
year4
emergency4
reservists4
ama4
students4
into4
professional4
avoid4
04
percent4
physical4
14
published4
resist4
medicine4
1990-19914
doctor4
might4
deferment4
physicians3
serve3
east3
says3
american3
qualify3
oath3
plan3
exemption3
their3
profession3
allied3
life3
orders3
middle3
women3
which3
leave3
cos3
president3
licensing3
armed3
start3
through3
make3
age3
deployment3
surgeons3
casualties3
journal3
needs3
new3
past3
few3
soldiers3
even3
time3
technicians3
army3
join3
youll3
fight3
special3
said3
since3
specialists3
include3
one3
wont3
last3
23
fiscal3
ready3
trained3
register3
33
hope3
essential3
including3
standby3
delivery3
public3
support3

Who hosts Medicaldraft.info?

Medicaldraft.info Hosting Provider Information

Hosted IP Address:64.68.200.46
Hosted Hostname:url-fwd.easydns.com
Service Provider:easyDNS Technologies, Inc.
Hosted Country:CanadaCA
Location Latitude:43.6319
Location Longitude:-79.3716
Webserver Software:nginx

Is "easyDNS Technologies, Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
38.7768%
GoDaddy.com, LLC
20.0663%
Namecheap, Inc.
9.8730%
Confluence Networks Inc
6.3707%
Google Inc.
6.0392%
Merit Network Inc.
4.3939%
Amazon.com, Inc.
4.2919%
1&1 Internet AG
4.2685%
Fara Negar Pardaz Khuzestan
3.8053%
Cogent Communications
3.5576%
easyDNS Technologies, Inc.
0.0315%

HTTP Header Analysis for Medicaldraft.info

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: nginx
Date: Sat, 31 Oct 2020 18:33:18 GMT
Content-Type: text/html
Content-Length: 162
Connection: keep-alive
Location: https://hasbrouck.org/draft/health.html

Medicaldraft.info Domain Nameserver Information

HostIP AddressCountry
nirvana.easydns.net 45.79.142.6
rush.easydns.com 46.101.120.153
motorhead.easydns.org 173.255.247.224


Need to find out who hosts Medicaldraft.info?


Domain Registration (WhoIs) information for Medicaldraft.info

 Domain Name: MEDICALDRAFT.INFO
Registry Domain ID: D7783800-LRMS
Registrar WHOIS Server: whois.easydns.com
Registrar URL: http://www.easydns.com
Updated Date: 2020-10-05T13:17:01Z
Creation Date: 2004-10-20T18:36:58Z
Registry Expiry Date: 2021-10-20T18:36:58Z
Registrar Registration Expiration Date:
Registrar: easyDNS Technologies Inc.
Registrar IANA ID: 469
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Data Protected
Registrant State/Province: ON
Registrant Country: CA
Name Server: NIRVANA.EASYDNS.NET
Name Server: RUSH.EASYDNS.COM
Name Server: MOTORHEAD.EASYDNS.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-10-31T18:32:19Z

Websites with Similar Names

Medic-abc.ru
Medic-ABC.ru - cимптомы, лечение, болезни
Medic-access.com
MEDICACCESS
Medic-accountants.org
Medic Accountants
Medic-alert.org
medic-alert.org - Deleted
Medic-alert.site
medic-alert.site

Recently Updated Websites

Letsenhance.io (11 minutes 47 seconds ago.)Publicitarioscriativos.com (11 minutes 54 seconds ago.)Cursodereiki.online (16 minutes 20 seconds ago.)Vlxx.xyz (24 minutes 44 seconds ago.)24sevenjobtalk.com (1 hour 10 minutes ago.)Pipsli.net (1 hour 20 minutes ago.)Forsna.com (1 hour 36 minutes ago.)Macnomed.com (1 hour 44 minutes ago.)Easyeducation22.com (2 hours 1 minute ago.)Fantomcomics.com (2 hours 14 minutes ago.)Naimorrisftlauderdale.com (2 hours 14 minutes ago.)Wrightwritingservices.com (2 hours 14 minutes ago.)Virtualmall.discount (2 hours 14 minutes ago.)Scovills.gs (2 hours 14 minutes ago.)Tenbux.com (2 hours 14 minutes ago.)Dovelife.org (2 hours 14 minutes ago.)Learntheanimalslite.com (2 hours 14 minutes ago.)Bestsale.be (2 hours 14 minutes ago.)Zoomflashmob.com (2 hours 14 minutes ago.)Kissfm-medan.com (2 hours 15 minutes ago.)Yybet4689.com (2 hours 15 minutes ago.)Jackmillerco.com (2 hours 15 minutes ago.)Patrickhundley.com (2 hours 15 minutes ago.)Telegraph.charitiestrust.org (2 hours 15 minutes ago.)Pexels.ru (2 hours 15 minutes ago.)Skiptracing360.com (2 hours 15 minutes ago.)Frostburgfootballcamps.com (2 hours 15 minutes ago.)Goooooooooooooooooooooooooooooooooooooogle.com (2 hours 15 minutes ago.)Minibiff.com (2 hours 15 minutes ago.)Jns588.com (2 hours 15 minutes ago.)

Recently Searched Keywords

mongols (1 second ago.)20ms visibility (3 seconds ago.)td-drop-down-searchbefore (3 seconds ago.)up3221q (4 seconds ago.)2020年9月9日 (4 seconds ago.)hardest thumbs (7 seconds ago.)freight forwarding (7 seconds ago.)medico centre (8 seconds ago.)regeln verliert man beim abnehmen erst wasser tage. (10 seconds ago.)sensital (11 seconds ago.)学生培养 (11 seconds ago.)thực phẩm sạch khát vọng của mọi nhà (12 seconds ago.)yatrma (16 seconds ago.)cupidatat skateboard (17 seconds ago.)essblinkslist liessbtotalcountitem essbtrbig (20 seconds ago.)satın almak istiyorum (21 seconds ago.)ambiental (22 seconds ago.)ariadna majewska (23 seconds ago.)solid rgba228 (24 seconds ago.)cd291a background-image (25 seconds ago.)fa trophy - qualification (27 seconds ago.)media min-width 768px (29 seconds ago.)follow us on (32 seconds ago.)1000000 highprice lowprice (37 seconds ago.)why not (37 seconds ago.)twisting and stranding machine (42 seconds ago.)airlines euroleague (43 seconds ago.)intelligent design (45 seconds ago.)zašto izabrati nas (45 seconds ago.)секс инцест (47 seconds ago.)