Medpex.de  |  403 Forbidden
Low trust score  | 



Medpex.de Website Information

Website Ranks & Scores for Medpex.de

Statvoo Rank Statvoo Rank:E
Alexa Rank Alexa Rank:28,263
Majestic Rank Majestic Rank:120,488
Domain Authority Domain Authority:49%
DMOZ DMOZ Listing:No

Whois information for medpex.de

Full Whois Lookup for Medpex.de Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Medpex.de. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: medpex.de
Nserver: logan.ns.cloudflare.com
Nserver: uma.ns.cloudflare.com
Status: connect
Changed: 2016-02-05T19:56:06+01:00

[Tech-C]
Type: PERSON
Name: Tobias Kindlieb
Address: Industriestr. 111
PostalCode: 67063
City: Ludwigshafen am Rhein
CountryCode: DE
Phone: +49.1803663388741
Fax: +49.1803663388752
Email: Login to show email
2013-08-12T12:40:33+02:00

[Zone-C]
Type: PERSON
Name: Tobias Kindlieb
Address: Industriestr. 111
PostalCode: 67063
City: Ludwigshafen am Rhein
CountryCode: DE
Phone: +49.1803663388741
Fax: +49.1803663388752
Email: Login to show email
2013-08-12T12:40:33+02:00

Who hosts Medpex.de?

Medpex.de is hosted by Host Europe GmbH in Nordrhein-westfalen, Koeln, Germany, 51147.
Medpex.de has an IP Address of 83.169.49.130 and a hostname of ds83-169-49-130.dedicated.hosteurope.de.



Medpex.de Web Server Information

Hosted IP Address:83.169.49.130
Hosted Hostname:ds83-169-49-130.dedicated.hosteurope.de
Service Provider:Host Europe GmbH
Hosted Country:GermanyDE
Location Latitude:50.9333
Location Longitude:6.95
Webserver Software:Not Applicable
Google Map of 50,12

HTTP Header Analysis for Medpex.de

Http-Version: 1.1
Status-Code: 403
Status: 403 Forbidden
Server: nginx
Date: Sat, 13 Jun 2015 07:42:37 GMT
Content-Type: text/html; charset=ISO-8859-1
Content-Length: 162
Connection: keep-alive
Keep-Alive: timeout=15


Need to find out who hosts Medpex.de?

Medpex.de Free SEO Report

Website Inpage Analysis for Medpex.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Medpex.de

gtlta class034arrowsmalloktober 2017034auchmedpexdatatrackingpromotionid0343745309034 datatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034pinimentholdatatrackingpromotionid034571748034 datatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034grippostadapothekeaushref034magenbeschwerdeniberogastp514644034 title034iberogast034 datatrackingpromotionid034514644034datatrackingpromotionid0345954715034 datatrackingpromotionname034welcomepage034datatrackingpromotionid03480000095034 datatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034lieblingclass034arrowsmallclass034sp2p spstarzudatatrackingpromotioncreative034liebling desclass034small034gttablettenif jsondatalengthdatatrackingpromotioncreative034antistax extraoderie vitamintitle034lieblingtitle034remifemin034 datatrackingpromotionid0342372214034immun granulatdatatrackingpromotioncreative034iberogast034monats oktober 20170344title034antistaxhref034schnupfennebenhoehlengelomyrtolfortep1479163034 title034gelomyrtol forte034gtltspanclass034product034sp2p034imtitle034pinimenthol erkltungssalbe034class034quoteitem034gtltdiv class034productlistentry034gtltastck n3ltspangtltdiv class034rating034gtlta0zuruumlckclass034sp2p spstar spstar5034gtltagtltspaneintabletten034 datatrackingpromotionid0348654623034 datatrackingpromotionname034welcomepage034title034vigantolettenmonats oktoberdatatrackingpromotionid034571748034title034nisylen tabletten034 datatrackingpromotionid0348654623034datatrackingpromotioncreative034orthomol immunclass034arrowsmall sp2p034bestellungkaufentitle034pinimentholmedpex versandapothekenachhref034vitamindvigantoletten1000ievitamind3tablettenp1245459034 title034vigantolettenservicedatatrackingpromotioncreative034vigantoletten 1000 iedatatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034pinimentholdatatrackingpromotionid0341479163034 datatrackingpromotionname034welcomepage034arzneimittelhtmldecodeltli class034quoteitem034gtltdiv class034productlistentry034gtltadatatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034gelomyrtold3 tabletten034datatrackingpromotioncreative034vigantoletten 1000tuumlv rheinlandjsondatalengthgranulat beutel034href034erkaeltunghomoeopathischekomplexmittelnisylentablettenp8654623034href034immunstaerkungorthomolimmungranulatbeutelp1319962034 title034orthomol immundatatrackingpromotioncreative034lieblinggtlta class034arrowsmall sp2p034class034rating034gtltaampeuroltspangtltbr gtlta class034arrowsmallheight034120034jsondatapushcontenttitle034grippostad c034 datatrackingpromotionid034571748034qualitaumlt ampextra venentabletten034 datatrackingpromotionid0345954715034title034iberogast034allefalsebeutel034 datatrackingpromotionid0341319962034 datatrackingpromotionname034welcomepage034datatrackingpromotioncreative034gelomyrtol forte034datatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034remifemin034des monats oktobervarwerdentitle034orthomol immun granulattitle034nisylen tabletten034gtltagtltbrtitle034liebling desfuumlrtitle034remifemin034 datatrackingpromotionid0342372214034 datatrackingpromotionname034welcomepage034datatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034pinimenthol erkltungssalbe034datatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034orthomol immunclass034quoteitem034gtltdivkontaktifdatatrackingpromotionid0341319962034ampeuroltspangtltbr gtltspann3ltspangtltdivhref034wechseljahreremifeminp2372214034datatrackingpromotioncreative034pinimentholbepanthenclass034sp2phref034magenbeschwerdeniberogastp514644034 title034iberogast034gtltatabletten034 datatrackingpromotionid0341245459034rezeptumhtmldecodeltli class034quoteitem034gtltdivdiehref034erkaeltunghomoeopathischekomplexmittelnisylentablettenp8654623034 title034nisylenweiterstckltspangtltdivdernullvenentabletten034themenshopsgtltspan class034small034gttablettentrusted shops51000 ie vitaminhref034lieblingdesmonatslieblingdesmonatsoktober2017p80000095034datatrackingpromotioncreative034nisylen tabletten034htmldecodeltlidatatrackingpromotioncreative034grippostad c034title034iberogast034 datatrackingpromotionid034514644034 datatrackingpromotionname034welcomepage034spstar5034gtltagtltspan class034reviewquantity034gtltaversandamphref034venenstaerkungantistaxextravenentablettenp5954715034 title034antistaxampeuroltspangtltbrquoteitemqualitaumlttabletten034datatrackingpromotioncreative034nisyleneurostckdatatrackingpromotionid0341245459034 datatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034vigantolettenprodukteerkltungssalbe034 datatrackingpromotionid0343745309034datatrackingpromotionid0343745309034 datatrackingpromotionname034welcomepage034datatrackingpromotionid0345954715034 datatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034antistaxhref034wechseljahreremifeminp2372214034 title034remifemin034forte034 datatrackingpromotionid0341479163034 datatrackingpromotionname034welcomepage034title034pinimenthol erkltungssalbe034 datatrackingpromotionid0343745309034angebotegtltspan class034sp2pmehrdatatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034nisylen tabletten034truejsondatapushcontent htmldecodeltlidatatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034iberogast034href034wechseljahreremifeminp2372214034 title034remifemin034 datatrackingpromotionid0342372214034oktoberhref034erkaeltungspraeparategrippostadcp571748034gtltbgtltahref034magenbeschwerdeniberogastp514644034datatrackingpromotionid034514644034 datatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034iberogast034stck n3ltspangtltdivdatatrackingpromotionid034571748034 datatrackingpromotionname034welcomepage034spstar spstar5034gtltagtltspandatatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034liebling destitle034iberogast034 datatrackingpromotionid034514644034datatrackingpromotionid0341319962034 datatrackingpromotionname034welcomepage034typedatatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034grippostadsichhref034erkaeltungspraeparategrippostadcp571748034 title034grippostadrheinlandbestsellerforte034href034erkaeltunghomoeopathischekomplexmittelnisylentablettenp8654623034 title034nisylen tabletten034tabletten034 datatrackingpromotionid0341245459034 datatrackingpromotionname034welcomepage034datatrackingpromotionid0342372214034 datatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034remifemin034datatrackingpromotionid0343745309034shopstitle034grippostad c034plusschmerztablettendatatrackingpromotioncreative034pinimenthol erkltungssalbe034gtltagtltbr gtltbgtltaimmun granulat beutel034tuumlvdatatrackingpromotionid0341479163034href034immunstaerkungorthomolimmungranulatbeutelp1319962034 title034orthomolabbishref034inhalationeinreibungpinimentholerkaeltungssalbep3745309034urltitle034remifemin034datatrackingpromotioncreative034liebling des monatsdatatrackingpromotionid0348654623034title034liebling des monatskundenhref034inhalationeinreibungpinimentholerkaeltungssalbep3745309034 title034pinimenthol erkltungssalbe034datatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034nisylendatatrackingpromotionid03480000095034class034productlistentry034gtltadatatrackingpromotionid0348654623034 datatrackingpromotionname034welcomepage034jsondatapushcontent htmldecodeltli class034quoteitem034gtltdivtitle034orthomol immunhref034venenstaerkungantistaxextravenentablettenp5954715034die medpexdatatrackingpromotioncreative034antistax extra venentabletten034href034vitamindvigantoletten1000ievitamind3tablettenp1245459034 title034vigantoletten 1000datatrackingpromotioncreative034gelomyrtolakuthref034schnupfennebenhoehlengelomyrtolfortep1479163034href034immunstaerkungorthomolimmungranulatbeutelp1319962034datatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034antistaxdatatrackingpromotionid0341479163034 datatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034gelomyrtol3immunonlinevitamin d3 tabletten034title034vigantoletten 1000 iebeutel034datatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034antistax extradatatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034gelomyrtol forte034granulatampeuroltspangtltbr gtltavitaminbeutel034 datatrackingpromotionid0341319962034spstar5034gtltagtltspanmitihrebeitrustedtsd3dendesjsondatatitle034orthomoleinloumlsenmedpex appwidth034120034height034120034 width034120034 class034product034swiperslideschnell2017034 datatrackingpromotionid03480000095034istie vitamin d3href034venenstaerkungantistaxextravenentablettenp5954715034 title034antistax extrastckltspangtltdiv class034rating034gtltaaufonline apothekehref034lieblingdesmonatslieblingdesmonatsoktober2017p80000095034 title034liebling desclass034reviewquantity034gtltaqualitaumlt amp sicherheitsieiedatatrackingpromotioncreative034orthomol immun granulathref034schnupfennebenhoehlengelomyrtolfortep1479163034 title034gelomyrtol1000 iegranulat beutel034 datatrackingpromotionid0341319962034amp sicherheitheight034120034 width034120034extraalsfalse falsedatatrackingpromotionid0342372214034n3ltspangtltdiv class034rating034gtltadatatrackingpromotioncreative034vigantolettend3 tabletten034 datatrackingpromotionid0341245459034c034href034inhalationeinreibungpinimentholerkaeltungssalbep3745309034 title034pinimentholquoteitem swiperslide jsondatapushcontenthref034erkaeltungspraeparategrippostadcp571748034 title034grippostad c034title034nisylendatatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034orthomoldatatrackingpromotionid03480000095034 datatrackingpromotionname034welcomepage034extra venentabletten034title034vigantoletten 1000datatrackingpromotioncreative034remifemin034title034antistax extra venentabletten034datatrackingpromotioncreative034grippostaddatatrackingpromotionname034welcomepage034kosmetikdatatrackingpromotionid0341245459034datatrackingpromotionid0342372214034 datatrackingpromotionname034welcomepage034forte034 datatrackingpromotionid0341479163034datatrackingpromotioncreative034orthomoldatatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034vigantoletten 1000100 stckc034 datatrackingpromotionid034571748034 datatrackingpromotionname034welcomepage0342100 stck n3ltspangtltdivtitle034gelomyrtolhref034vitamindvigantoletten1000ievitamind3tablettenp1245459034des monatsdatatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034vigantolettendatatrackingpromotioncreative034antistaxtitle034antistax extratitle034gelomyrtol forte034swiperslide jsondatapushcontent htmldecodeltliwidth034120034 class034product034datatrackingpromotionid0345954715034c034 datatrackingpromotionid034571748034quoteitem swiperslidespstarswiperslide jsondatapushcontentweiter zuruumlckuumlberdatatrackingpromotionid0341319962034 datatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034orthomoldatatrackingpromotionid034514644034functionvenentabletten034 datatrackingpromotionid0345954715034 datatrackingpromotionname034welcomepage034erkltungssalbe034 datatrackingpromotionid0343745309034 datatrackingpromotionname034welcomepage034title034gelomyrtol forte034 datatrackingpromotionid0341479163034appdatatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034grippostad c034dasgratisoktober 2017034 datatrackingpromotionid03480000095034erkltungssalbe0341datatrackingpromotionid034514644034 datatrackingpromotionname034welcomepage034datatrackingpromotionid0348654623034 datatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034nisylensicherheithref034lieblingdesmonatslieblingdesmonatsoktober2017p80000095034 title034liebling2017034 datatrackingpromotionid03480000095034 datatrackingpromotionname034welcomepage034vitamin d3uhrversandapothekedatatrackingpromotionid0341245459034 datatrackingpromotionname034welcomepage034tabletten034 datatrackingpromotionid0348654623034title034grippostadzumspstar spstar5034gtltagtltspan class034reviewquantity034gtltamonatsdatatrackingpromotionname034welcomepage034 datatrackingpromotioncreative034lieblingvenentabletten034 datatrackingpromotionid0345954715034

Longtail Keyword Density for Medpex.de

KeywordsOccurences
1000 ie vitamin12
ie vitamin d312
height034120034 width034120034 class034product03410
jsondatapushcontent htmldecodeltli class034quoteitem034gtltdiv10
htmldecodeltli class034quoteitem034gtltdiv class034productlistentry034gtlta10
gtlta class034arrow-small sp2p03410
ampeuroltspangtltbr gtlta class034arrow-small10
vitamin d3 tabletten0349
swiper-slide jsondatapushcontent htmldecodeltli9
quoteitem swiper-slide jsondatapushcontent9
sp-star sp-star-5034gtltagtltspan class034reviewquantity034gtlta9
class034sp2p sp-star sp-star-5034gtltagtltspan9
des monats oktober9
immun granulat beutel0349
monats oktober 20170347
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034gelomyrtol forte0345
data-tracking-promotion-id0341479163034 data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034gelomyrtol5
data-tracking-promotion-id0341319962034 data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034orthomol5
data-tracking-promotion-creative034vigantoletten 1000 ie5
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034vigantoletten 10005
data-tracking-promotion-id0341245459034 data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034vigantoletten5
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034orthomol immun5
data-tracking-promotion-creative034orthomol immun granulat5
data-tracking-promotion-id0343745309034 data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034pinimenthol5
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034grippostad c0345
data-tracking-promotion-creative034antistax extra venentabletten0345
data-tracking-promotion-id0348654623034 data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034nisylen5
data-tracking-promotion-id034514644034 data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034iberogast0345
data-tracking-promotion-id034571748034 data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034grippostad5
data-tracking-promotion-id0342372214034 data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034remifemin0345
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034nisylen tabletten0345
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034pinimenthol erkltungssalbe0345
data-tracking-promotion-id0345954715034 data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034antistax5
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034antistax extra5
title034pinimenthol erkltungssalbe034 data-tracking-promotion-id03437453090343
href034inhalation-einreibungpinimenthol-erkaeltungssalbe-p3745309034 title034pinimenthol erkltungssalbe0343
href034magenbeschwerdeniberogast-p514644034 title034iberogast034 data-tracking-promotion-id0345146440343
title034iberogast034 data-tracking-promotion-id034514644034 data-tracking-promotion-name034welcome-page0343
erkltungssalbe034 data-tracking-promotion-id0343745309034 data-tracking-promotion-name034welcome-page0343
title034remifemin034 data-tracking-promotion-id0342372214034 data-tracking-promotion-name034welcome-page0343
forte034 data-tracking-promotion-id0341479163034 data-tracking-promotion-name034welcome-page0343
href034erkaeltungspraeparategrippostad-c-p571748034 title034grippostad c0343
title034gelomyrtol forte034 data-tracking-promotion-id03414791630343
href034schnupfen-nebenhoehlengelomyrtol-forte-p1479163034 title034gelomyrtol forte0343
title034grippostad c034 data-tracking-promotion-id0345717480343
c034 data-tracking-promotion-id034571748034 data-tracking-promotion-name034welcome-page0343
href034wechseljahreremifemin-p2372214034 title034remifemin034 data-tracking-promotion-id03423722140343
qualitaumlt amp sicherheit3
tabletten034 data-tracking-promotion-id0348654623034 data-tracking-promotion-name034welcome-page0343
extra venentabletten034 data-tracking-promotion-id03459547150343
href034liebling-des-monatsliebling-des-monats-oktober-2017-p80000095034 title034liebling des3
title034liebling des monats3
oktober 2017034 data-tracking-promotion-id034800000950343
2017034 data-tracking-promotion-id03480000095034 data-tracking-promotion-name034welcome-page0343
data-tracking-promotion-id03480000095034 data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034liebling3
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034liebling des3
data-tracking-promotion-creative034liebling des monats3
href034venenstaerkungantistax-extra-venentabletten-p5954715034 title034antistax extra3
title034antistax extra venentabletten0343
venentabletten034 data-tracking-promotion-id0345954715034 data-tracking-promotion-name034welcome-page0343
title034nisylen tabletten034 data-tracking-promotion-id03486546230343
href034vitamin-dvigantoletten-1-000-i-e-vitamin-d3-tabletten-p1245459034 title034vigantoletten 10003
title034vigantoletten 1000 ie3
d3 tabletten034 data-tracking-promotion-id03412454590343
tabletten034 data-tracking-promotion-id0341245459034 data-tracking-promotion-name034welcome-page0343
stck n3ltspangtltdiv class034rating034gtlta3
href034immunstaerkungorthomol-immun-granulat-beutel-p1319962034 title034orthomol immun3
title034orthomol immun granulat3
granulat beutel034 data-tracking-promotion-id03413199620343
beutel034 data-tracking-promotion-id0341319962034 data-tracking-promotion-name034welcome-page0343
href034erkaeltung-homoeopathische-komplexmittelnisylen-tabletten-p8654623034 title034nisylen tabletten0343
100 stck n3ltspangtltdiv3
ie vitamin12
vitamin d312
1000 ie12
immun granulat11
quoteitem swiper-slide10
class034arrow-small sp2p03410
gtlta class034arrow-small10
ampeuroltspangtltbr gtlta10
ampeuroltspangtltbr gtltspan10
gtltspan class034sp2p10
gtltagtltbr gtltbgtlta10
height034120034 width03412003410
width034120034 class034product03410
htmldecodeltli class034quoteitem034gtltdiv10
class034quoteitem034gtltdiv class034productlistentry034gtlta10
jsondatapushcontent htmldecodeltli10
swiper-slide jsondatapushcontent9
monats oktober9
d3 tabletten0349
extra venentabletten0349
des monats9
class034sp2p sp-star9
sp-star sp-star-5034gtltagtltspan9
granulat beutel0349
sp-star-5034gtltagtltspan class034reviewquantity034gtlta9
online apotheke7
oktober 20170347
100 stck6
data-tracking-promotion-creative034pinimenthol erkltungssalbe0345
data-tracking-promotion-id0341245459034 data-tracking-promotion-name034welcome-page0345
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034pinimenthol5
data-tracking-promotion-id0348654623034 data-tracking-promotion-name034welcome-page0345
data-tracking-promotion-creative034vigantoletten 10005
data-tracking-promotion-id0343745309034 data-tracking-promotion-name034welcome-page0345
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034nisylen5
data-tracking-promotion-id0341479163034 data-tracking-promotion-name034welcome-page0345
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034gelomyrtol5
data-tracking-promotion-creative034orthomol immun5
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034orthomol5
data-tracking-promotion-id0341319962034 data-tracking-promotion-name034welcome-page0345
data-tracking-promotion-creative034gelomyrtol forte0345
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034vigantoletten5
data-tracking-promotion-id0345954715034 data-tracking-promotion-name034welcome-page0345
data-tracking-promotion-creative034nisylen tabletten0345
data-tracking-promotion-id034514644034 data-tracking-promotion-name034welcome-page0345
data-tracking-promotion-creative034antistax extra5
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034antistax5
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034iberogast0345
data-tracking-promotion-id0342372214034 data-tracking-promotion-name034welcome-page0345
data-tracking-promotion-creative034grippostad c0345
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034grippostad5
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034remifemin0345
data-tracking-promotion-id034571748034 data-tracking-promotion-name034welcome-page0345
medpex versandapotheke4
n3ltspangtltdiv class034rating034gtlta4
c034 data-tracking-promotion-id0345717480343
die medpex3
forte034 data-tracking-promotion-id03414791630343
false false3
href034magenbeschwerdeniberogast-p514644034 title034iberogast0343
title034grippostad c0343
href034erkaeltungspraeparategrippostad-c-p571748034 title034grippostad3
title034iberogast034 data-tracking-promotion-id0345146440343
title034pinimenthol erkltungssalbe0343
erkltungssalbe034 data-tracking-promotion-id03437453090343
title034remifemin034 data-tracking-promotion-id03423722140343
href034wechseljahreremifemin-p2372214034 title034remifemin0343
title034gelomyrtol forte0343
href034inhalation-einreibungpinimenthol-erkaeltungssalbe-p3745309034 title034pinimenthol3
trusted shops3
href034schnupfen-nebenhoehlengelomyrtol-forte-p1479163034 title034gelomyrtol3
title034antistax extra3
qualitaumlt amp3
amp sicherheit3
weiter zuruumlck3
if jsondatalength3
href034liebling-des-monatsliebling-des-monats-oktober-2017-p80000095034 title034liebling3
title034liebling des3
2017034 data-tracking-promotion-id034800000950343
data-tracking-promotion-id03480000095034 data-tracking-promotion-name034welcome-page0343
data-tracking-promotion-name034welcome-page034 data-tracking-promotion-creative034liebling3
data-tracking-promotion-creative034liebling des3
href034venenstaerkungantistax-extra-venentabletten-p5954715034 title034antistax3
venentabletten034 data-tracking-promotion-id03459547150343
tabletten034 data-tracking-promotion-id03486546230343
stckltspangtltdiv class034rating034gtlta3
href034vitamin-dvigantoletten-1-000-i-e-vitamin-d3-tabletten-p1245459034 title034vigantoletten3
title034vigantoletten 10003
tabletten034 data-tracking-promotion-id03412454590343
tuumlv rheinland3
gtltspan class034small034gttabletten3
stck n3ltspangtltdiv3
href034immunstaerkungorthomol-immun-granulat-beutel-p1319962034 title034orthomol3
title034orthomol immun3
beutel034 data-tracking-promotion-id03413199620343
href034erkaeltung-homoeopathische-komplexmittelnisylen-tabletten-p8654623034 title034nisylen3
title034nisylen tabletten0343
medpex app3
data-tracking-promotion-name034welcome-page03448
gtltspan30
amp26
ampeuroltspangtltbr20
class034sp2p19
tabletten03418
die14
var14
sie14
medpex14
d312
vitamin12
ie12
012
der12
granulat11
jsondatapushcontent11
immun11
des11
extra11
class034productlistentry034gtlta10
class034quoteitem034gtltdiv10
width03412003410
htmldecodeltli10
gtlta10
class034arrow-small10
gtltbgtlta10
swiper-slide10
sp2p03410
gtltagtltbr10
height03412003410
class034product03410
quoteitem10
oktober9
sp-star-5034gtltagtltspan9
forte0349
erkltungssalbe0349
monats9
venentabletten0349
beutel0349
c0349
apotheke9
sp-star9
class034rating034gtlta9
class034reviewquantity034gtlta9
function9
false8
true8
stck8
18
online7
27
bei6
fuumlr6
versandapotheke6
das6
ihre6
zu6
if6
oder6
data-tracking-promotion-creative034pinimenthol5
data-tracking-promotion-creative034gelomyrtol5
data-tracking-promotion-id03486546230345
data-tracking-promotion-id03414791630345
data-tracking-promotion-creative034nisylen5
data-tracking-promotion-id03412454590345
data-tracking-promotion-id0345146440345
data-tracking-promotion-creative034iberogast0345
data-tracking-promotion-creative034grippostad5
data-tracking-promotion-creative034orthomol5
data-tracking-promotion-id0345717480345
data-tracking-promotion-creative034antistax5
data-tracking-promotion-creative034remifemin0345
data-tracking-promotion-id03423722140345
data-tracking-promotion-creative034vigantoletten5
data-tracking-promotion-id03413199620345
data-tracking-promotion-id03459547150345
data-tracking-promotion-id03437453090345
type5
im5
ist5
mit5
uumlber5
n3ltspangtltdiv4
alle4
rezept4
qualitaumlt4
sicherheit4
versand4
euro4
34
jsondata4
schmerztabletten4
sich4
null4
bis4
arzneimittel4
werden3
title034iberogast0343
href034magenbeschwerdeniberogast-p5146440343
kosmetik3
nach3
zum3
43
uhr3
href034wechseljahreremifemin-p23722140343
title034remifemin0343
auf3
produkte3
ein3
auch3
href034erkaeltungspraeparategrippostad-c-p5717480343
plus3
akut3
title034grippostad3
bepanthen3
bestseller3
themenshops3
den3
trusted3
title034pinimenthol3
url3
um3
bestellung3
aus3
ts3
einloumlsen3
kontakt3
service3
kaufen3
zuruumlck3
gratis3
schnell3
ab3
kunden3
als3
mehr3
rheinland3
tuumlv3
weiter3
jsondatalength3
href034inhalation-einreibungpinimenthol-erkaeltungssalbe-p37453090343
href034vitamin-dvigantoletten-1-000-i-e-vitamin-d3-tabletten-p12454590343
title034gelomyrtol3
href034schnupfen-nebenhoehlengelomyrtol-forte-p14791630343
title034nisylen3
href034erkaeltung-homoeopathische-komplexmittelnisylen-tabletten-p86546230343
title034orthomol3
href034immunstaerkungorthomol-immun-granulat-beutel-p13199620343
class034small034gttabletten3
title034vigantoletten3
stckltspangtltdiv3
53
shops3
title034antistax3
href034venenstaerkungantistax-extra-venentabletten-p59547150343
data-tracking-promotion-creative034liebling3
data-tracking-promotion-id034800000950343
title034liebling3
href034liebling-des-monatsliebling-des-monats-oktober-2017-p800000950343
angebote3
app3

What are the nameservers for medpex.de?

Medpex.de Domain Nameserver Information

HostIP AddressCountry
ns1.hans.hosteurope.de 217.115.143.140Germany Germany
ns2.hans.hosteurope.de 80.237.128.10Germany Germany

Medpex.de DNS Record Analysis DNS Lookup

HostTypeTTLExtra
medpex.deA86396IP: 83.169.49.130
medpex.deNS259200Target: ns1.hans.hosteurope.de
medpex.deNS259200Target: ns2.hans.hosteurope.de
medpex.deSOA2560MNAME: ns1.hans.hosteurope.de
RNAME: hostmaster.medpex.de
Serial: 2015051314
Refresh: 16384
Retry: 2048
Expire: 1048576
medpex.deMX86400Priority: 10
Target: mail.medpex.de
medpex.deTXT86400TXT: v=spf1 a mx ip4:217.160.7.78
ip4:212.227.15.0/24
include:servers.mcsv.net
include:spf.mandrillapp.com
include:emsmtp.com include:emarsys.net
~all
medpex.deTXT86400TXT: google-site-verification=Zc37EO3aEAkFC37
MAxd9cD3qlWJrsC6vaSpW-VNTl6Q

Alexa Traffic Rank for Medpex.de


Alexa Search Engine Traffic for Medpex.de