Medsovet.info Website Analysis Summary

Medsovet.info  |  ???µ?????†???????????? ???????‚?°?» medsovet.info - ???±?€???????°?? ?±?°?·?° ?????°?‡?µ?? ?? ???»???????? ???????????°.
Low trust score  | 
??????????? ?????? medsovet.info


Rank
193,397
Rating
G
Trust Score
Low Trust Score
Estimated worth
$64,800
Estimated daily income
$108
Estimated monthly income
$3,285
Backlinks
0

Medsovet.info has a Low Trust Score, and a Statvoo Rank of G.

Medsovet.info is hosted by OOO Network of data-centers Selectel in Saint Petersburg City, Saint Petersburg, Russian Federation, 191015.
Medsovet.info has an IP Address of 188.93.18.77 and a hostname of 188.93.18.77.

The domain medsovet.info was registered 1 decade 4 years 2 months ago by , it was last modified 201 decades 9 years 4 months ago and currently is set to expire 201 decades 9 years 4 months ago.

It is the world's 193,397 most popular site among over 300 million websites.

Medsovet.info has a total of 0 backlinks.

Medsovet.info gets approximately 8,645 unique visitors a day and 43,225 pageviews per day.

Medsovet.info has an estimated worth of $64,800.
An average daily income of approximately $108, which is wroughly $3,285 per month.

Whois information for medsovet.info

Full Whois Lookup for Medsovet.info Whois Lookup

Domain Name: MEDSOVET.INFO
Registry Domain ID: D11495454-LRMS
Registrar WHOIS Server:
Registrar URL: http://www.onlinenic.com
Updated Date: 2016-10-28T08:33:06Z
Creation Date: 2005-12-12T08:23:35Z
Registry Expiry Date: 2017-12-12T08:23:35Z
Registrar Registration Expiration Date:
Registrar: OnlineNIC, Inc.
Registrar IANA ID: 82
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C94753237-LRMS
Registrant Name: Synthes Book
Registrant Organization: Synthes Book
Registrant Street: 64-1-A-521 Serdobolskaya str.
Registrant City: St.Petersburg
Registrant State/Province: na
Registrant Postal Code: 197342
Registrant Country: RU
Registrant Phone: +7.8127035398
Registrant Phone Ext:
Registrant Fax: +7.8127035398
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C94753234-LRMS
Admin Name: Synthes Book
Admin Organization: Synthes Book
Admin Street: 64-1-A-521 Serdobolskaya str.
Admin City: St.Petersburg
Admin State/Province: na
Admin Postal Code: 197342
Admin Country: RU
Admin Phone: +7.8127035398
Admin Phone Ext:
Admin Fax: +7.8127035398
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C94753235-LRMS
Tech Name: Synthes Book
Tech Organization: Synthes Book
Tech Street: 64-1-A-521 Serdobolskaya str.
Tech City: St.Petersburg
Tech State/Province: na
Tech Postal Code: 197342
Tech Country: RU
Tech Phone: +7.8127035398
Tech Phone Ext:
Tech Fax: +7.8127035398
Tech Fax Ext:
Tech Email: Login to show email
Billing ID: C94753236-LRMS
Billing Name: Synthes Book
Billing Organization: Synthes Book
Billing Street: 64-1-A-521 Serdobolskaya str.
Billing City: St.Petersburg
Billing State/Province: na
Billing Postal Code: 197342
Billing Country: RU
Billing Phone: +7.8127035398
Billing Phone Ext:
Billing Fax: +7.8127035398
Billing Fax Ext:
Billing Email: Login to show email
Server: NS1.NAMESELF.COM
Name Server: NS2.NAMESELF.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-09-16T00:52:16Z

Who hosts Medsovet.info?

Medsovet.info Web Server Information

Hosted IP Address:188.93.18.77
Hosted Hostname:188.93.18.77
Service Provider:OOO Network of data-centers Selectel
Hosted Country:RussiaRU
Location Latitude:59.8944
Location Longitude:30.2642
Webserver Software:Not Applicable

HTTP Header Analysis for Medsovet.info

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Thu, 25 Jun 2015 20:55:48 GMT
Content-Type: text/html; charset=windows-1251
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Expires: Thu, 25 Jun 2015 21:00:48 GMT
Cache-Control: max-age=300
Pragma: no-cache
Content-Encoding: gzip

Need to find out who hosts Medsovet.info?

Medsovet.info Free SEO Report

Website Inpage Analysis for Medsovet.info

H1 Headings:1
Медицинский интернет-портал Medsovet.info
H2 Headings:2
Где купить лекарства
Последние отзывы о лекарствах
H3 Headings:7
Лекарства
Больницы, клиники
Лекарства и БАДы
поиск на картемед.учреждений
Новости медицины
статьи
Рейтингмед.учреждений
H4 Headings:8
для Пациентов
для Врачей
Регистрация
Последние отзывы к клиникам
Последние сообщения на форуме
Акции клиник
3D-ТУРы Больниц и клиник
MEDSOVET.INFO АПТЕКИ
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:19
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Medsovet.info

msdoctaddclassthisattrdatastoragequeryreturn truesearchresults aremovefunction e2else if evtkeycodevar screenx0focusoutparamvar screenx0 windowscrollleftcontainm returnclosedropwindowscrolltop var screenx1vare ifscreenx0 windowscrollleft varwindowinnerheight ifmsmenuv2removeclassmsherbviewpercent 09 varfoldwindowinnerheightundefined yacounter8134843paramsadsview5evtkeycodemshosp mspativar screeny009 var viewkoefitemlengthquery typeelement settingssif msmenuv2lengthscreenx1 windowscrollleftnm break case4viewviewkoef var screenx0mshsschtml mshsinputattrplaceholder cchnbspreturn true varnmscrollloadpagefunction wscreeny1 windowscrolltopwindowinnerwidth varwindowscrollleft var screeny0mspati msdoctaddclassthisattrdatamenuitemactive trianglefadeinfastvar screeny0 windowscrolltopmedsovetinfowindowscrollleft windowinnerwidth vartouchmoveif screenx0windowscrollleftifeventwhichundefined yacounter8134843params undefinedsettingsundefinedscreenx0viewkoef 1windowscrollleft windowinnerwidthkeyviewpercentsitmsviewuho13wnfalse functionvar viewkoef 1scroll touchmove mspointermovethischildrensubmenulength11windowonload scroll touchmovemsmenuv2removeclassmsherb mshosp mspativiewpercent 09var viewpercent 09windowscrollleft varmenuitemactiveelementqueryif thischildrensubmenulengthuho3x0screenx1 windowscrollleft windowinnerwidthvar viewkoefvar screenx1 windowscrollleftnyacounter8134843paramsfunction element settingswindowscrolltop windowinnerheight if8mshsschtml mshsinputattrplaceholdervar screenx1mshsschtmlblockidviewuho2screenx0 windowscrollleftscroll touchmoveismobile1screeny0 windowscrolltop109windowonloadscreeny0yacounter8134843params undefined yacounter8134843paramsadsview1 viewpercentwindowscrolltop windowinnerheightaremoveelse sitmswindowinnerwidthdatascreenx1thresholdwindowonload scrollscrollviewkoef varresponsecallvar screeny1 windowscrolltopmspointermovefunction elementwindowinnerwidth var screeny1caseresponsesearchresultsheadersearchanswerlistsearcheif evtkeycodeviewuho3itemselectindextruecchelse ifsuccessevtwindowlocationhrefuho2heightuho1heightfunction ifreturn falsescreeny1 windowscrolltop windowinnerheightmshosp mspati msdoctaddclassthisattrdatayacounter8134843params undefinedmshsinputattrplaceholderfalsemshsinputattrplaceholder cchuho2x0functiontouchmove mspointermovewindowscrolltop varsettimeoutfunctionviewkoef 1 viewpercentfunction var13true varthisvalmsmenuv2length msmenuv2removeclassmsherbtrue var viewpercentyacounter8134843paramsadsviewifuho3heightnm breakbreakmspativar screeny1trianglefadeinfastscreeny0 windowscrolltop varmsmenuv2length msmenuv2removeclassmsherb mshosptypescreeny1closeanswertviewkoef6returnundefined yacounter8134843paramsviewpercent varwindowinnerheight if screenx0ifheadersearchanswerlistelseif msmenuv2length msmenuv2removeclassmsherb09wthreshold 0t71 viewpercent varmbreak casewindowscrolltop0msmenuv2lengthinitheadersearch12var viewpercentuho1x0mshospmsmenuv2removeclassmsherb mshosp09 var

Longtail Keyword Density for Medsovet.info

KeywordsOccurences
ms-h-s-s-chtml ms-h-s-inputattrplaceholder cch9
nm break case7
undefined yacounter8134843params undefined5
yacounter8134843params undefined yacounter8134843paramsadsview5
ms-menu-v2length ms-menu-v2removeclassms-herb ms-hosp4
ms-menu-v2removeclassms-herb ms-hosp ms-pati4
if ms-menu-v2length ms-menu-v2removeclassms-herb4
var screenx1 windowscrollleft3
screenx1 windowscrollleft windowinnerwidth3
var screeny0 windowscrolltop3
screeny0 windowscrolltop var3
windowscrolltop var screenx13
windowscrollleft windowinnerwidth var3
windowscrolltop windowinnerheight if3
windowonload scroll touchmove3
scroll touchmove mspointermove3
windowinnerheight if screenx03
windowscrollleft var screeny03
var screeny1 windowscrolltop3
screeny1 windowscrolltop windowinnerheight3
windowinnerwidth var screeny13
1 viewpercent var3
return true var3
true var viewpercent3
function element settings3
ms-hosp ms-pati ms-doctaddclassthisattrdata3
else if evtkeycode3
var viewpercent 093
viewpercent 09 var3
viewkoef var screenx03
var screenx0 windowscrollleft3
viewkoef 1 viewpercent3
var viewkoef 13
09 var viewkoef3
screenx0 windowscrollleft var3
break case14
ms-h-s-inputattrplaceholder cch9
nm break9
ms-h-s-s-chtml ms-h-s-inputattrplaceholder9
function if8
ms-hosp ms-pati6
viewkoef var6
m return5
yacounter8134843params undefined5
undefined yacounter8134843paramsadsview5
threshold 05
undefined yacounter8134843params5
ms-menu-v2length ms-menu-v2removeclassms-herb4
if evtkeycode4
return true4
query type4
if ms-menu-v2length4
ms-menu-v2removeclassms-herb ms-hosp4
menuitemactive trianglefadeinfast4
else sitms4
true var4
windowscrollleft var3
windowscrollleft windowinnerwidth3
screenx1 windowscrollleft3
screenx0 windowscrollleft3
windowscrolltop var3
windowinnerwidth var3
var screeny03
screeny0 windowscrolltop3
var screenx13
screeny1 windowscrolltop3
windowonload scroll3
scroll touchmove3
touchmove mspointermove3
if screenx03
windowinnerheight if3
var screenx03
windowscrolltop windowinnerheight3
var screeny13
09 var3
function element3
element settings3
return false3
if thischildrensubmenulength3
e if3
else if3
ms-pati ms-doctaddclassthisattrdata3
function e3
searchresults aremove3
false function3
viewkoef 13
1 viewpercent3
viewpercent var3
var viewkoef3
function var3
var viewpercent3
viewpercent 093
function w3
var73
function63
if55
020
else18
break18
return18
case16
true15
nbsp12
false12
cch12
query11
nm11
undefined11
type11
viewkoef9
ms-h-s-s-chtml9
ms-h-s-inputattrplaceholder9
windowscrolltop8
18
sitms8
medsovetinfo8
windowscrollleft7
settings7
menuitemactive6
screeny06
screenx16
screeny16
screenx06
viewpercent6
ms-pati6
yacounter8134843paramsadsview6
evtkeycode6
ms-hosp6
t6
e6
settimeoutfunction6
threshold5
response5
responsecall5
yacounter8134843params5
m5
25
contain5
s5
data5
ms-menu-v2length4
trianglefadeinfast4
34
closedrop4
id4
44
fold4
view4
closeanswert4
wn4
54
param4
ms-menu-v2removeclassms-herb4
64
itemlength4
74
search4
storagequery4
thisval4
header-search-answer-list4
83
windowinnerwidth3
w3
93
uho1x03
n3
uho3height3
uho3x03
103
uho1height3
windowinnerheight3
mspointermove3
viewuho23
uho2x03
viewuho13
touchmove3
windowonload3
093
scroll3
uho2height3
searchresults3
focusout3
ms-doctaddclassthisattrdata3
113
thischildrensubmenulength3
ismobile3
itemselectindex3
initheadersearch3
block3
ifeventwhich3
element3
123
scrollloadpage3
aremove3
viewuho33
ifheader-search-answer-list3
evt3
success3
windowlocationhref3
133
key3

What are the nameservers for medsovet.info?

Medsovet.info Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown