Meenatravels.in  |  Welcome to Meena Travels
Low trust score  | 

Meenatravels.in Website Information

Meenatravels.in has a Low Trust Score, a Statvoo Rank of I, an Alexa Rank of 0, a Majestic Rank of 0, a Domain Authority of 0% and is not listed in DMOZ.

Meenatravels.in is hosted by CtrlS Datacenters Ltd. in Telangana, Hyderabad, India, 500025.
Meenatravels.in has an IP Address of 202.65.137.187 and a hostname of mail.abhibus.com.

The domain meenatravels.in was registered 6 years 5 months 6 days ago by , it was last modified 4 years 5 months 3 days ago and currently is set to expire 3 years 5 months 3 days ago.


Whois information for meenatravels.in

Full Whois Lookup for Meenatravels.in Whois Lookup

Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only, and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.

Domain ID:D7064683-AFIN
Domain Name:MEENATRAVELS.IN
Created On:12-Feb-2013 11:27:43 UTC
Last Updated On:30-Jan-2017 05:37:07 UTC
Expiration Date:12-Feb-2018 11:27:43 UTC
Sponsoring Registrar:GoDaddy.com, LLC (R101-AFIN)
Status:CLIENT DELETE PROHIBITED
Reason:
Status:CLIENT RENEW PROHIBITED
Reason:
Status:CLIENT TRANSFER PROHIBITED
Reason:
Status:CLIENT UPDATE PROHIBITED
Reason:
Registrant ID:CR239653571
Registrant Name:Sudhakar Chirra
Registrant Organization:Abhibus Services India Pvt Ltd.
Registrant Street1:1st Floor,Lakshmi Towers, Panjagutta,
Registrant Street2:Nagarjuna Hills
Registrant Street3:
Registrant City:Hyderabad
Registrant State/Province:Andhra Pradesh
Registrant Postal Code:500082
Registrant Country:IN
Registrant Phone:+91.4049102345
Registrant Phone Ext.:
Registrant FAX:
Registrant FAX Ext.:
Registrant Login to show email
ID:CR239653573
Admin Name:Sudhakar Chirra
Admin Organization:Abhibus Services India Pvt Ltd.
Admin Street1:1st Floor,Lakshmi Towers, Panjagutta,
Admin Street2:Nagarjuna Hills
Admin Street3:
Admin City:Hyderabad
Admin State/Province:Andhra Pradesh
Admin Postal Code:500082
Admin Country:IN
Admin Phone:+91.4049102345
Admin Phone Ext.:
Admin FAX:
Admin FAX Ext.:
Admin Login to show email
ID:CR239653572
Tech Name:Sudhakar Chirra
Tech Organization:Abhibus Services India Pvt Ltd.
Tech Street1:1st Floor,Lakshmi Towers, Panjagutta,
Tech Street2:Nagarjuna Hills
Tech Street3:
Tech City:Hyderabad
Tech State/Province:Andhra Pradesh
Tech Postal Code:500082
Tech Country:IN
Tech Phone:+91.4049102345
Tech Phone Ext.:
Tech FAX:
Tech FAX Ext.:
Tech Login to show email
Server:NS2.LINODE.COM
Name Server:NS1.LINODE.COM
Name Server:NS3.LINODE.COM
Name Server:NS4.LINODE.COM
Name Server:NS5.LINODE.COM
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
Name Server:
DNSSEC:Unsigned

Who hosts Meenatravels.in?

Meenatravels.in Web Server Information

Hosted IP Address:202.65.137.187
Hosted Hostname:mail.abhibus.com
Service Provider:CtrlS Datacenters Ltd.
Hosted Country:IndiaIN
Location Latitude:17.3753
Location Longitude:78.4744
Webserver Software:Not Applicable

HTTP Header Analysis for Meenatravels.in

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 07 Jan 2016 14:16:23 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: private, no-cache, no-store, proxy-revalidate, no-transform
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 3991
Content-Type: text/html


Need to find out who hosts Meenatravels.in?

Meenatravels.in Free SEO Report

Website Inpage Analysis for Meenatravels.in

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Meenatravels.in

1 buttonimageonlypopupslidefirstday 1 buttonimageonlybuttonimage cdnassets0cfr5inticketsimplynetassetscalendarf4d7f97d865bdd869ff80f24b72518114b833a6df4917301e13499d6721f8ac1gif dateformat0rightnumberofmonths 2mindate maxdatebuttonimage cdnassets0cfr5inticketsimplynetassetscalendarf4d7f97d865bdd869ff80f24b72518114b833a6df4917301e13499d6721f8ac1gifdateformat ddmmyyfold showbuttonpanelbuttonimageonly true showanimcdnassets0cfr5inticketsimplynetassetscalendarf4d7f97d865bdd869ff80f24b72518114b833a6df4917301e13499d6721f8ac1gif dateformattrueagentshowbuttonpaneltrue showanim foldtrue showanimcdnassets0cfr5inticketsimplynetassetscalendarf4d7f97d865bdd869ff80f24b72518114b833a6df4917301e13499d6721f8ac1gif dateformat ddmmyyoption2numberofmonths 2 firstdaybuttonimageonlywidth2 firstdayshowon bothcdnassets0cfr5inticketsimplynetassetscalendarf4d7f97d865bdd869ff80f24b72518114b833a6df4917301e13499d6721f8ac1gifddmmyy numberofmonths 2ddmmyydateformat ddmmyy numberofmonthsshowanim fold showbuttonpanelfirstday 1numberofmonths1showbuttonpanel trueshowanimfold showbuttonpanel true2 firstday 1mindate1 buttonimageonly truemaxdatefeedbackddmmyy numberofmonthsbothshowonfolddateformatbuttonimageonly trueshowanim foldfunctionbuttonimagefirstdaychangemonthchangemonth truevar

Longtail Keyword Density for Meenatravels.in

KeywordsOccurences
buttonimageonly true showanim3
1 buttonimageonly true3
true showanim fold3
showanim fold showbuttonpanel3
fold showbuttonpanel true3
firstday 1 buttonimageonly3
2 firstday 13
cdn-assets0-cf-r5inticketsimplynetassetscalendar-f4d7f97d865bdd869ff80f24b72518114b833a6df4917301e13499d6721f8ac1gif dateformat ddmmyy3
dateformat ddmmyy numberofmonths3
ddmmyy numberofmonths 23
numberofmonths 2 firstday3
buttonimage cdn-assets0-cf-r5inticketsimplynetassetscalendar-f4d7f97d865bdd869ff80f24b72518114b833a6df4917301e13499d6721f8ac1gif dateformat3
numberofmonths 24
true showanim3
buttonimageonly true3
showanim fold3
showbuttonpanel true3
mindate maxdate3
1 buttonimageonly3
fold showbuttonpanel3
2 firstday3
buttonimage cdn-assets0-cf-r5inticketsimplynetassetscalendar-f4d7f97d865bdd869ff80f24b72518114b833a6df4917301e13499d6721f8ac1gif3
showon both3
cdn-assets0-cf-r5inticketsimplynetassetscalendar-f4d7f97d865bdd869ff80f24b72518114b833a6df4917301e13499d6721f8ac1gif dateformat3
dateformat ddmmyy3
changemonth true3
ddmmyy numberofmonths3
firstday 13
true11
var7
maxdate6
popupslide5
numberofmonths4
04
mindate4
width4
function4
showanim3
buttonimageonly3
13
fold3
firstday3
23
option3
showbuttonpanel3
buttonimage3
changemonth3
feedback3
agent3
showon3
both3
dateformat3
cdn-assets0-cf-r5inticketsimplynetassetscalendar-f4d7f97d865bdd869ff80f24b72518114b833a6df4917301e13499d6721f8ac1gif3
right3
ddmmyy3

What are the nameservers for meenatravels.in?

Meenatravels.in Domain Nameserver Information

HostIP AddressCountry
ns27.domaincontrol.com 97.74.103.14United States United States
ns28.domaincontrol.com 173.201.71.14United States United States

Meenatravels.in Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Meenatravels.in is a scam?