Menshealth.deMenshealth.de

Fitness, Fashion & Lifestyle für aktive Männer | MEN'S HEALTH

MensHealth bringt Männer in Form: Mit vielen Tipps zu den Themen Gesundheit, Fitness, Food, Style und Love.

Add a review Follow site (0)

Category: Health > Mens Health

Change category Claim this site

menshealth, home

Useful Searches

menshealth.com/uk/arms20 download

Domain summary

Safety	Low trust score
Year Founded	2021
Global Traffic Rank	99,218
Estimated Worth	$153,360
Last updated	2021-10-05
Domain label	menshealth
Domain extension	de
Statvoo Rating	E
Estimated daily income	$213
Estimated monthly income	$6,479

Frequently Asked Questions (FAQ)

Q: When was Menshealth.de registered?

A: Menshealth.de was registered 8 months, 3 weeks, 2 days, 3 hours, 24 minutes, 45 seconds ago on Tuesday, October 5, 2021.

Q: When was the WHOIS for Menshealth.de last updated?

A: The WHOIS entry was last updated 1 year, 1 month, 1 day, 3 hours, 24 minutes, 45 seconds ago on Thursday, May 27, 2021.

Q: What are Menshealth.de's nameservers?

A: DNS for Menshealth.de is provided by the following nameservers:

ns-1407.awsdns-47.org
ns-1746.awsdns-26.co.uk
ns-44.awsdns-05.com
ns-850.awsdns-42.net

Q: Who is the registrar for the Menshealth.de domain?

A: The domain has been registered at DENIC eG.

Q: What is the traffic rank for Menshealth.de?

A: Menshealth.de ranks 99,218 globally on Alexa. Menshealth.de has a Low Trust Score, and a Statvoo Rank of E.

Q: How many people visit Menshealth.de each day?

A: Menshealth.de receives approximately 17,739 visitors and 106,434 page impressions per day.

Q: What IP address does Menshealth.de resolve to?

A: Menshealth.de resolves to the IPv4 address .

Q: In what country are Menshealth.de servers located in?

A: Menshealth.de has servers located in the .

Q: What webserver software does Menshealth.de use?

A: Menshealth.de is powered by Nginx webserver.

Q: Who hosts Menshealth.de?

A: Menshealth.de is hosted by Unknown in .

Q: How much is Menshealth.de worth?

A: Menshealth.de has an estimated worth of $153,360. An average daily income of approximately $213, which is roughly $6,479 per month.

Menshealth.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Menshealth.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Menshealth.de

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

50 :

Google Adsense

Not Applicable

Google Analytics

UA-2607287-1

Links - Internal

80:

Show 75 more items

Links - Internal (nofollow)

https://www.menshealth.de/rss-feeds
https://www.menshealth.de/rss-feeds

Links - Outbound

27:

Show 22 more items

Links - Outbound (nofollow)

https://www.instagram.com/menshealth.de/
https://www.instagram.com/menshealth.de/
https://www.facebook.com/MensHealth.de/
https://www.facebook.com/MensHealth.de/
https://www.pinterest.de/menshealthde/
https://www.pinterest.de/menshealthde/
https://www.youtube.com/channel/UCa9Rb1uDZxBsdg63j455kzw
https://www.youtube.com/channel/UCa9Rb1uDZxBsdg63j455kzw

Keyword Cloud for Menshealth.de

disableinitialloadfalse windowmpsownundefined windowmpsowndie bestenfitnesstcdataeventstatus cmpuishown elseein refreshjetztgegendo something elsesuccess try ifsdmdefzonemusscalled morekinderif success ifundefined typeof sdmdefzonemehrconsoledebugerror iffalsedisableinitialload wird automatischwatchcarecalled more thanalskgif tcdataeventstatus tcloadedvorliegendem disableinitialload wirderfolgen ausschaltengesetzt iffoodwieautomatisch ein refreshdirif typeofnot getdentcdatatcstringvon42 success ifaxel bossealternativ neu bei2 successelse consoleloghiertcfapiremoveeventlistenerworldgetsdmdefzone sdmdefzonetcdataeventstatus useractioncompletevarsomethingundefined windowmpsown windowmpsownslotsinitialtcfapiremoveeventlistener 2 successoderbei vorliegendemremovebossecalledumohbeitcdatalistenerid else ifcallidxspsec2bei vorliegendem disableinitialloadthan once tcfapiremoveeventlistenerelse if tcdataeventstatuswirdthan oncetcdataeventstatustypeof windowmpsowndiesenload muss individuellerdisable initialthanwindowmpsownautomatisch einmore than oncesdmdefzone jsonparse300245ausschalten mitinitial load300x245settargetingtagnamezu den angebotenmuss individuellerderneu bei vorliegendemtcdatatcdataeventstatus useractioncomplete doabfragenmiterfolgenhierzurtcdata success tryohneresp disable initialrefresh gesetztfalse alternativ neuzuerror consoledebugerrordisable initial loadtrainingsplanabsuccess if tcdataeventstatususeractioncomplete dodo somethingundefinedif tcdataeventstatusfrhstckuseractioncomplete do somethingwird automatischwindowmpsown typeofcmpuishown elsewochenberdu deineconsentstringpresent undefined consentstringpresentzumtypeof windowmpsown undefinedcanvassneakertypeof consentstringpresenttcdataeventstatus cmpuishowndemconsentstringpresent falseamp careausschaltenconsoleloghier istfinancial loadcarbsuccess ifschimpfensolltestgewinnspiele0sexrestfunctionschieftcdataeventstatus tcloadedgood tcdatalistenerid elseist was schiefdieseneu beidisableinitialload wirdwindowmpsown windowmpsownslotsabfragen varelse do somethingconsoledebugerror if typeofindividuellergelaufen catchwindowmpsownslots windowmpsownslotstry if successonceelse tcfapiaddeventlistener 2catch errorwindowmpsown undefined windowmpsownconsentstringpresent undefinedgoogletagdefineslot1057534menshealthdermp sdmdefzonemuskulsersdmdefzone sdmdefzone restsuccessgmbherfolgen ausschalten mitdodu3gegen rckenschmerzengoogletagdefineslot1057534menshealthdermpelse ifpfvtwonorefreshden angebotendeine kinderfitnessernhrungstyleundefined consentstringpresent falsedisablerefresh erfolgenrest functiondurchoh good tcdatalisteneridrefresh erfolgen ausschaltenhatsuccess if successcoeinenvorliegendem disableinitialloadmit diesenerror consoledebugerror ifelse doourself to notgmbh co kgrefresh gesetzt ifmuss individueller refreshapplelovegoogletagcmdpushfunction vartcdatatcstring consentstringpresentapiconsentstringpresent truetrywindowmpsown undefinedwindowmpsown windowmpsownslots windowmpsownslotsfalse alternativmslidiesomething elsenach demtcloaded tcdataeventstatus useractioncompletenachgesetztgmbh coonce tcfapiremoveeventlistenertcfapiaddeventlistenersdmdefzone rest functionapi abfragen varschief gelaufenoh good2 wochenbeziehungwie duimbungengoodnewslettermen39sohne gerterckenvaterhealthbei metatagjsonparse300245googletagdefineslot1057534menshealthdermp sdmdefzone jsonparse300245get calleddeinenindividueller refresh erfolgensomething else consoleloghieraxelsinddasmotorcmpuishown else docallidxspsec3more thanfinancialtypeof sdmdefzonewirkentcdataeventstatus tcloaded tcdataeventstatusundefined typeofistif success ohkrafttrainingtrainingsplnedeinewirremove the ourselfourselfrckenschmerzendadapi abfragenif typeof consentstringpresentein refresh gesetztzur rubriksuccess ohsdmdefzone restzu dennot get calleddeingelaufen catch errorfalse windowmpsown typeofmoreeincatchbehandlungrespwindowmpsown typeof windowmpsownneuloadmetatag resp disableelse tcfapiaddeventlistenersomething with tcdatatcstringtcdatalisteneridbei metatag respcatch error consoledebugerrortypeofgelaufenschief gelaufen catchsportgesetzt if googletagpubadsisinitialloaddisabledmit pfvtwonorefreshonce tcfapiremoveeventlistener 2consoleloghierifausschalten mit pfvtwonorefreshresp disablesuccess oh goodessentcfapiremoveeventlistener 2podcastinitial load mussload mussget called morelifetypeof sdmdefzone sdmdefzoneapple watchwird automatisch einelseruumlckengoogletagcmdpushfunctionmetatagerrorgood tcdatalisteneridampmotor presseundefined consentstringpresentnurdu deine kinderfrif tcdataeventstatus cmpuishownautomatischnotangebotenwindowmpsownslotswie du deineindividueller refreshtcdata successbestenerziehstmetatag respgoogletagpubadsisinitialloaddisabledtcdatatcstring consentstringpresent truevorliegendemif successrubrikrefreshif googletagpubadsisinitialloaddisabledsieco kgalternativ neuuseractioncompletealternativconsoledebugerrorplanobelse consoleloghier isterrichtigsoconsentstringpresentgoogletagenableservices2sdmdefzone undefined typeof1unseretry ifcallidxspsec1typeof consentstringpresent undefinedsdmdefzone undefinedsprichttcdatalistenerid elsetruetcloaded tcdataeventstatussuccess trygertepressetcloadedcmpuishowngehttcfapiaddeventlistener 2

Longtail Keyword Density for Menshealth.de

Keywords	Occurrences
du deine kinder	4
zu den angeboten	3
once tcfapiremoveeventlistener 2	3
good tcdatalistenerid else	3
oh good tcdatalistenerid	3
success oh good	3
if success oh	3
success if success	3
2 success if	3
tcfapiremoveeventlistener 2 success	3
more than once	3
than once tcfapiremoveeventlistener	3
else if tcdataeventstatus	3
called more than	3
get called more	3
not get called	3
ourself to not	3
remove the ourself	3
tcdatatcstring consentstringpresent true	3
something with tcdatatcstring	3
tcdatalistenerid else if	3
if tcdataeventstatus cmpuishown	3
tcdataeventstatus useractioncomplete do	3
error consoledebugerror if	3
wie du deine	3
else tcfapiaddeventlistener 2	3
undefined consentstringpresent false	3
consentstringpresent undefined consentstringpresent	3
typeof consentstringpresent undefined	3
if typeof consentstringpresent	3
consoledebugerror if typeof	3
catch error consoledebugerror	3
tcdataeventstatus cmpuishown else	3
gelaufen catch error	3
schief gelaufen catch	3
ist was schief	3
else consoleloghier ist	3
something else consoleloghier	3
do something else	3
else do something	3
cmpuishown else do	3
useractioncomplete do something	3
tcloaded tcdataeventstatus useractioncomplete	3
sdmdefzone undefined typeof	3
initial load muss	3
alternativ neu bei	3
false alternativ neu	3
ausschalten mit pfvtwonorefresh	3
erfolgen ausschalten mit	3
refresh erfolgen ausschalten	3
individueller refresh erfolgen	3
muss individueller refresh	3
load muss individueller	3
disable initial load	3
bei vorliegendem disableinitialload	3
resp disable initial	3
metatag resp disable	3
bei metatag resp	3
googletagdefineslot1057534menshealthdermp sdmdefzone jsonparse300245	3
sdmdefzone rest function	3
sdmdefzone sdmdefzone rest	3
typeof sdmdefzone sdmdefzone	3
undefined typeof sdmdefzone	3
neu bei vorliegendem	3
vorliegendem disableinitialload wird	3
tcdataeventstatus tcloaded tcdataeventstatus	3
undefined windowmpsown windowmpsownslots	3
if tcdataeventstatus tcloaded	3
success if tcdataeventstatus	3
if success if	3
try if success	3
success try if	3
tcdata success try	3
api abfragen var	3
windowmpsown windowmpsownslots windowmpsownslots	3
windowmpsown undefined windowmpsown	3
disableinitialload wird automatisch	3
typeof windowmpsown undefined	3
windowmpsown typeof windowmpsown	3
false windowmpsown typeof	3
gesetzt if googletagpubadsisinitialloaddisabled	3
refresh gesetzt if	3
ein refresh gesetzt	3
automatisch ein refresh	3
wird automatisch ein	3
gmbh co kg	3
zur rubrik	8
wie du	7
if tcdataeventstatus	6
success if	6
if success	6
do something	6
du deine	6
die besten	5
mit diesen	4
2 wochen	4
financial load	4
deine kinder	4
ohne gerte	4
gegen rckenschmerzen	4
oh good	3
good tcdatalistenerid	3
zu den	3
tcdatalistenerid else	3
2 success	3
else if	3
tcdataeventstatus cmpuishown	3
success oh	3
get called	3
tcfapiremoveeventlistener 2	3
once tcfapiremoveeventlistener	3
than once	3
more than	3
called more	3
else do	3
not get	3
consentstringpresent true	3
cmpuishown else	3
catch error	3
something else	3
consentstringpresent false	3
gmbh co	3
motor presse	3
apple watch	3
amp care	3
axel bosse	3
nach dem	3
tcfapiaddeventlistener 2	3
else tcfapiaddeventlistener	3
undefined consentstringpresent	3
else consoleloghier	3
consentstringpresent undefined	3
typeof consentstringpresent	3
if typeof	3
consoledebugerror if	3
error consoledebugerror	3
gelaufen catch	3
schief gelaufen	3
consoleloghier ist	3
tcdatatcstring consentstringpresent	3
tcdataeventstatus tcloaded	3
useractioncomplete do	3
resp disable	3
mit pfvtwonorefresh	3
ausschalten mit	3
erfolgen ausschalten	3
refresh erfolgen	3
individueller refresh	3
muss individueller	3
load muss	3
initial load	3
disable initial	3
metatag resp	3
alternativ neu	3
bei metatag	3
sdmdefzone jsonparse300245	3
googletagdefineslot1057534menshealthdermp sdmdefzone	3
googletagcmdpushfunction var	3
rest function	3
sdmdefzone rest	3
sdmdefzone sdmdefzone	3
typeof sdmdefzone	3
undefined typeof	3
sdmdefzone undefined	3
false alternativ	3
neu bei	3
tcdataeventstatus useractioncomplete	3
windowmpsown undefined	3
tcloaded tcdataeventstatus	3
den angeboten	3
try if	3
success try	3
tcdata success	3
abfragen var	3
api abfragen	3
windowmpsownslots windowmpsownslots	3
windowmpsown windowmpsownslots	3
undefined windowmpsown	3
typeof windowmpsown	3
bei vorliegendem	3
windowmpsown typeof	3
false windowmpsown	3
if googletagpubadsisinitialloaddisabled	3
gesetzt if	3
refresh gesetzt	3
ein refresh	3
automatisch ein	3
wird automatisch	3
disableinitialload wird	3
vorliegendem disableinitialload	3
co kg	3
du	27
die	24
if	18
mit	14
der	13
wie	13
so	13
bei	13
sdmdefzone	12
0	12
else	12
success	12
rckenschmerzen	11
das	11
den	10
fr	10
zur	10
zu	10
consentstringpresent	9
tcdataeventstatus	9
undefined	9
typeof	9
windowmpsown	9
ist	9
false	9
besten	9
amp	9
deine	8
ohne	8
rubrik	8
load	7
health	7
trainingsplne	7
als	6
sport	6
var	6
krafttraining	6
hat	6
windowmpsownslots	6
oder	6
something	6
ein	6
dein	6
do	6
refresh	6
im	6
diese	6
sind	5
men39s	5
diesen	5
wochen	5
jetzt	5
gerte	4
motor	4
essen	4
solltest	4
fitness	4
podcast	4
dir	4
gegen	4
1	4
apple	4
2	4
einen	4
um	4
financial	4
schimpfen	4
hier	4
sie	4
richtig	4
kinder	4
erziehst	4
durch	4
bosse	4
vater	4
beziehung	4
sex	4
zum	3
er	3
nach	3
callidxspsec3	3
bungen	3
callidxspsec2	3
dem	3
geht	3
deinen	3
care	3
co	3
gmbh	3
presse	3
3	3
gewinnspiele	3
watch	3
canvas-sneaker	3
behandlung	3
unsere	3
trainingsplan	3
von	3
carb	3
ber	3
spricht	3
axel	3
consoledebugerror	3
4	3
ob	3
wir	3
mehr	3
msli	3
frhstck	3
tcfapiaddeventlistener	3
tcdatatcstring	3
error	3
plan	3
individueller	3
muss	3
initial	3
disable	3
resp	3
metatag	3
googletagenableservices	3
300x245settargetingtagname	3
jsonparse300245	3
googletagdefineslot1057534menshealthdermp	3
googletagcmdpushfunction	3
callidxspsec1	3
function	3
rest	3
ruumlcken	3
ausschalten	3
nur	3
rcken	3
ab	3
fitness-ernhrung	3
wirken	3
muskulser	3
world	3
love	3
style	3
life	3
food	3
newsletter	3
dad	3
angeboten	3
erfolgen	3
pfvtwonorefresh	3
catch	3
ourself	3
gelaufen	3
schief	3
consoleloghier	3
cmpuishown	3
tcdatalistenerid	3
good	3
oh	3
tcfapiremoveeventlistener	3
once	3
than	3
more	3
called	3
get	3
not	3
remove	3
alternativ	3
true	3
useractioncomplete	3
tcloaded	3
try	3
tcdata	3
abfragen	3
api	3
googletagpubadsisinitialloaddisabled	3
gesetzt	3
automatisch	3
wird	3
disableinitialload	3
vorliegendem	3
neu	3
kg	3

Who hosts Menshealth.de?

Menshealth.de Hosting Provider Information

Hosted IP Address:	Not Applicable
Hosted Hostname:	Not Applicable
Service Provider:	Unknown
Hosted Country:	Not Applicable
Location Latitude:	Not Applicable
Location Longitude:	Not Applicable
Webserver Software:	nginx

Is "Unknown" in the Top 10 Hosting Companies?

Name

Percentage

Unknown

21.6445%

GOOGLE

14.1050%

AS-26496-GO-DADDY-COM-LLC

3.4726%

NAMECHEAP-NET

3.1524%

AMAZON-AES

2.2226%

GoDaddy.com, LLC

2.0265%

UNIFIEDLAYER-AS-1

1.9734%

Fara Negar Pardaz Khuzestan

1.6251%

CONFLUENCE-NETWORK-INC

1.4696%

AMAZON-02

1.3660%

Menshealth.de Domain Nameserver Information

Host	IP Address	Country
ns-1407.awsdns-47.org	205.251.197.127
ns-1746.awsdns-26.co.uk	205.251.198.210
ns-44.awsdns-05.com	205.251.192.44
ns-850.awsdns-42.net	205.251.195.82

Websites with Similar Names

Mensh.mobi
mensh.mobi - Registered at Namecheap.com

Mensh3althbestti1ps.com
404 Not Found

Mensh5.top

Mensha.wang
click.com.cn

Menshaat.com

Menshabits.com
MensHabits.com

Menshacker.com
パパ活アプリ比較 | メンズハッカー

Menshadow.com

Menshaelth.com

Menshafsoft.com
Login | Menshaf EYECARE

Recently Searched Keywords

winner one (1 second ago.), destei ablon (1 second ago.), saca (1 second ago.), kredyty gotowkowe ranking 2021 (1 second ago.), 2016 categories (1 second ago.), barnwood (1 second ago.), unit1s 2d einheit1s (1 second ago.), 信息公开受理 (1 second ago.), buy linkn n (2 seconds ago.), kings acres (2 seconds ago.), third person shooter switch (2 seconds ago.), 30px 5px (2 seconds ago.), webopac (3 seconds ago.), regional anesthesia (4 seconds ago.), crm auto (4 seconds ago.), auld kendal golden unflavoured (4 seconds ago.), seo ppc (5 seconds ago.), nopirkt (5 seconds ago.), use the new (7 seconds ago.), 俄语版 (7 seconds ago.), cch ly ti (7 seconds ago.), web banner (7 seconds ago.), no brasil e (8 seconds ago.), she was always (8 seconds ago.), uhr dooa workshop (8 seconds ago.), executive briefing (8 seconds ago.), dynamic-buttonhover (8 seconds ago.), hazr web (8 seconds ago.), she was always (8 seconds ago.), net organizasyon (9 seconds ago.),