Fitness, Fashion & Lifestyle für aktive Männer | MEN'S HEALTH

MensHealth bringt Männer in Form: Mit vielen Tipps zu den Themen Gesundheit, Fitness, Food, Style und Love.


Domain summary

SafetyLow trust score
Year Founded
2021
Global Traffic Rank
99,218
Estimated Worth
$153,360
Last updated
2021-10-05
Domain label
menshealth
Domain extension
de
Statvoo Rating
E
Estimated daily income
$213
Estimated monthly income
$6,479

Frequently Asked Questions (FAQ)

Q: When was Menshealth.de registered?
A: Menshealth.de was registered 8 months, 3 weeks, 2 days, 3 hours, 24 minutes, 45 seconds ago on Tuesday, October 5, 2021.
Q: When was the WHOIS for Menshealth.de last updated?
A: The WHOIS entry was last updated 1 year, 1 month, 1 day, 3 hours, 24 minutes, 45 seconds ago on Thursday, May 27, 2021.
Q: What are Menshealth.de's nameservers?
A: DNS for Menshealth.de is provided by the following nameservers:
  • ns-1407.awsdns-47.org
  • ns-1746.awsdns-26.co.uk
  • ns-44.awsdns-05.com
  • ns-850.awsdns-42.net
Q: Who is the registrar for the Menshealth.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Menshealth.de?
A: Menshealth.de ranks 99,218 globally on Alexa. Menshealth.de has a Low Trust Score, and a Statvoo Rank of E.
Q: How many people visit Menshealth.de each day?
A: Menshealth.de receives approximately 17,739 visitors and 106,434 page impressions per day.
Q: What IP address does Menshealth.de resolve to?
A: Menshealth.de resolves to the IPv4 address .
Q: In what country are Menshealth.de servers located in?
A: Menshealth.de has servers located in the .
Q: What webserver software does Menshealth.de use?
A: Menshealth.de is powered by Nginx webserver.
Q: Who hosts Menshealth.de?
A: Menshealth.de is hosted by Unknown in .
Q: How much is Menshealth.de worth?
A: Menshealth.de has an estimated worth of $153,360. An average daily income of approximately $213, which is roughly $6,479 per month.

Menshealth.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Menshealth.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Menshealth.de

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

50 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-2607287-1

Links - Internal

80:

Links - Internal (nofollow)

1:

Links - Outbound

27:

Links - Outbound (nofollow)

4:

Keyword Cloud for Menshealth.de

disableinitialloadfalse windowmpsownundefined windowmpsowndie bestenfitnesstcdataeventstatus cmpuishown elseein refreshjetztgegendo something elsesuccess try ifsdmdefzonemusscalled morekinderif success ifundefined typeof sdmdefzonemehrconsoledebugerror iffalsedisableinitialload wird automatischwatchcarecalled more thanalskgif tcdataeventstatus tcloadedvorliegendem disableinitialload wirderfolgen ausschaltengesetzt iffoodwieautomatisch ein refreshdirif typeofnot getdentcdatatcstringvon42 success ifaxel bossealternativ neu bei2 successelse consoleloghiertcfapiremoveeventlistenerworldgetsdmdefzone sdmdefzonetcdataeventstatus useractioncompletevarsomethingundefined windowmpsown windowmpsownslotsinitialtcfapiremoveeventlistener 2 successoderbei vorliegendemremovebossecalledumohbeitcdatalistenerid else ifcallidxspsec2bei vorliegendem disableinitialloadthan once tcfapiremoveeventlistenerelse if tcdataeventstatuswirdthan oncetcdataeventstatustypeof windowmpsowndiesenload muss individuellerdisable initialthanwindowmpsownautomatisch einmore than oncesdmdefzone jsonparse300245ausschalten mitinitial load300x245settargetingtagnamezu den angebotenmuss individuellerderneu bei vorliegendemtcdatatcdataeventstatus useractioncomplete doabfragenmiterfolgenhierzurtcdata success tryohneresp disable initialrefresh gesetztfalse alternativ neuzuerror consoledebugerrordisable initial loadtrainingsplanabsuccess if tcdataeventstatususeractioncomplete dodo somethingundefinedif tcdataeventstatusfrhstckuseractioncomplete do somethingwird automatischwindowmpsown typeofcmpuishown elsewochenberdu deineconsentstringpresent undefined consentstringpresentzumtypeof windowmpsown undefinedcanvassneakertypeof consentstringpresenttcdataeventstatus cmpuishowndemconsentstringpresent falseamp careausschaltenconsoleloghier istfinancial loadcarbsuccess ifschimpfensolltestgewinnspiele0sexrestfunctionschieftcdataeventstatus tcloadedgood tcdatalistenerid elseist was schiefdieseneu beidisableinitialload wirdwindowmpsown windowmpsownslotsabfragen varelse do somethingconsoledebugerror if typeofindividuellergelaufen catchwindowmpsownslots windowmpsownslotstry if successonceelse tcfapiaddeventlistener 2catch errorwindowmpsown undefined windowmpsownconsentstringpresent undefinedgoogletagdefineslot1057534menshealthdermp sdmdefzonemuskulsersdmdefzone sdmdefzone restsuccessgmbherfolgen ausschalten mitdodu3gegen rckenschmerzengoogletagdefineslot1057534menshealthdermpelse ifpfvtwonorefreshden angebotendeine kinderfitnessernhrungstyleundefined consentstringpresent falsedisablerefresh erfolgenrest functiondurchoh good tcdatalisteneridrefresh erfolgen ausschaltenhatsuccess if successcoeinenvorliegendem disableinitialloadmit diesenerror consoledebugerror ifelse doourself to notgmbh co kgrefresh gesetzt ifmuss individueller refreshapplelovegoogletagcmdpushfunction vartcdatatcstring consentstringpresentapiconsentstringpresent truetrywindowmpsown undefinedwindowmpsown windowmpsownslots windowmpsownslotsfalse alternativmslidiesomething elsenach demtcloaded tcdataeventstatus useractioncompletenachgesetztgmbh coonce tcfapiremoveeventlistenertcfapiaddeventlistenersdmdefzone rest functionapi abfragen varschief gelaufenoh good2 wochenbeziehungwie duimbungengoodnewslettermen39sohne gerterckenvaterhealthbei metatagjsonparse300245googletagdefineslot1057534menshealthdermp sdmdefzone jsonparse300245get calleddeinenindividueller refresh erfolgensomething else consoleloghieraxelsinddasmotorcmpuishown else docallidxspsec3more thanfinancialtypeof sdmdefzonewirkentcdataeventstatus tcloaded tcdataeventstatusundefined typeofistif success ohkrafttrainingtrainingsplnedeinewirremove the ourselfourselfrckenschmerzendadapi abfragenif typeof consentstringpresentein refresh gesetztzur rubriksuccess ohsdmdefzone restzu dennot get calleddeingelaufen catch errorfalse windowmpsown typeofmoreeincatchbehandlungrespwindowmpsown typeof windowmpsownneuloadmetatag resp disableelse tcfapiaddeventlistenersomething with tcdatatcstringtcdatalisteneridbei metatag respcatch error consoledebugerrortypeofgelaufenschief gelaufen catchsportgesetzt if googletagpubadsisinitialloaddisabledmit pfvtwonorefreshonce tcfapiremoveeventlistener 2consoleloghierifausschalten mit pfvtwonorefreshresp disablesuccess oh goodessentcfapiremoveeventlistener 2podcastinitial load mussload mussget called morelifetypeof sdmdefzone sdmdefzoneapple watchwird automatisch einelseruumlckengoogletagcmdpushfunctionmetatagerrorgood tcdatalisteneridampmotor presseundefined consentstringpresentnurdu deine kinderfrif tcdataeventstatus cmpuishownautomatischnotangebotenwindowmpsownslotswie du deineindividueller refreshtcdata successbestenerziehstmetatag respgoogletagpubadsisinitialloaddisabledtcdatatcstring consentstringpresent truevorliegendemif successrubrikrefreshif googletagpubadsisinitialloaddisabledsieco kgalternativ neuuseractioncompletealternativconsoledebugerrorplanobelse consoleloghier isterrichtigsoconsentstringpresentgoogletagenableservices2sdmdefzone undefined typeof1unseretry ifcallidxspsec1typeof consentstringpresent undefinedsdmdefzone undefinedsprichttcdatalistenerid elsetruetcloaded tcdataeventstatussuccess trygertepressetcloadedcmpuishowngehttcfapiaddeventlistener 2

Longtail Keyword Density for Menshealth.de

KeywordsOccurrences
du deine kinder4
zu den angeboten3
once tcfapiremoveeventlistener 23
good tcdatalistenerid else3
oh good tcdatalistenerid3
success oh good3
if success oh3
success if success3
2 success if3
tcfapiremoveeventlistener 2 success3
more than once3
than once tcfapiremoveeventlistener3
else if tcdataeventstatus3
called more than3
get called more3
not get called3
ourself to not3
remove the ourself3
tcdatatcstring consentstringpresent true3
something with tcdatatcstring3
tcdatalistenerid else if3
if tcdataeventstatus cmpuishown3
tcdataeventstatus useractioncomplete do3
error consoledebugerror if3
wie du deine3
else tcfapiaddeventlistener 23
undefined consentstringpresent false3
consentstringpresent undefined consentstringpresent3
typeof consentstringpresent undefined3
if typeof consentstringpresent3
consoledebugerror if typeof3
catch error consoledebugerror3
tcdataeventstatus cmpuishown else3
gelaufen catch error3
schief gelaufen catch3
ist was schief3
else consoleloghier ist3
something else consoleloghier3
do something else3
else do something3
cmpuishown else do3
useractioncomplete do something3
tcloaded tcdataeventstatus useractioncomplete3
sdmdefzone undefined typeof3
initial load muss3
alternativ neu bei3
false alternativ neu3
ausschalten mit pfvtwonorefresh3
erfolgen ausschalten mit3
refresh erfolgen ausschalten3
individueller refresh erfolgen3
muss individueller refresh3
load muss individueller3
disable initial load3
bei vorliegendem disableinitialload3
resp disable initial3
metatag resp disable3
bei metatag resp3
googletagdefineslot1057534menshealthdermp sdmdefzone jsonparse3002453
sdmdefzone rest function3
sdmdefzone sdmdefzone rest3
typeof sdmdefzone sdmdefzone3
undefined typeof sdmdefzone3
neu bei vorliegendem3
vorliegendem disableinitialload wird3
tcdataeventstatus tcloaded tcdataeventstatus3
undefined windowmpsown windowmpsownslots3
if tcdataeventstatus tcloaded3
success if tcdataeventstatus3
if success if3
try if success3
success try if3
tcdata success try3
api abfragen var3
windowmpsown windowmpsownslots windowmpsownslots3
windowmpsown undefined windowmpsown3
disableinitialload wird automatisch3
typeof windowmpsown undefined3
windowmpsown typeof windowmpsown3
false windowmpsown typeof3
gesetzt if googletagpubadsisinitialloaddisabled3
refresh gesetzt if3
ein refresh gesetzt3
automatisch ein refresh3
wird automatisch ein3
gmbh co kg3
zur rubrik8
wie du7
if tcdataeventstatus6
success if6
if success6
do something6
du deine6
die besten5
mit diesen4
2 wochen4
financial load4
deine kinder4
ohne gerte4
gegen rckenschmerzen4
oh good3
good tcdatalistenerid3
zu den3
tcdatalistenerid else3
2 success3
else if3
tcdataeventstatus cmpuishown3
success oh3
get called3
tcfapiremoveeventlistener 23
once tcfapiremoveeventlistener3
than once3
more than3
called more3
else do3
not get3
consentstringpresent true3
cmpuishown else3
catch error3
something else3
consentstringpresent false3
gmbh co3
motor presse3
apple watch3
amp care3
axel bosse3
nach dem3
tcfapiaddeventlistener 23
else tcfapiaddeventlistener3
undefined consentstringpresent3
else consoleloghier3
consentstringpresent undefined3
typeof consentstringpresent3
if typeof3
consoledebugerror if3
error consoledebugerror3
gelaufen catch3
schief gelaufen3
consoleloghier ist3
tcdatatcstring consentstringpresent3
tcdataeventstatus tcloaded3
useractioncomplete do3
resp disable3
mit pfvtwonorefresh3
ausschalten mit3
erfolgen ausschalten3
refresh erfolgen3
individueller refresh3
muss individueller3
load muss3
initial load3
disable initial3
metatag resp3
alternativ neu3
bei metatag3
sdmdefzone jsonparse3002453
googletagdefineslot1057534menshealthdermp sdmdefzone3
googletagcmdpushfunction var3
rest function3
sdmdefzone rest3
sdmdefzone sdmdefzone3
typeof sdmdefzone3
undefined typeof3
sdmdefzone undefined3
false alternativ3
neu bei3
tcdataeventstatus useractioncomplete3
windowmpsown undefined3
tcloaded tcdataeventstatus3
den angeboten3
try if3
success try3
tcdata success3
abfragen var3
api abfragen3
windowmpsownslots windowmpsownslots3
windowmpsown windowmpsownslots3
undefined windowmpsown3
typeof windowmpsown3
bei vorliegendem3
windowmpsown typeof3
false windowmpsown3
if googletagpubadsisinitialloaddisabled3
gesetzt if3
refresh gesetzt3
ein refresh3
automatisch ein3
wird automatisch3
disableinitialload wird3
vorliegendem disableinitialload3
co kg3
du27
die24
if18
mit14
der13
wie13
so13
bei13
sdmdefzone12
012
else12
success12
rckenschmerzen11
das11
den10
fr10
zur10
zu10
consentstringpresent9
tcdataeventstatus9
undefined9
typeof9
windowmpsown9
ist9
false9
besten9
amp9
deine8
ohne8
rubrik8
load7
health7
trainingsplne7
als6
sport6
var6
krafttraining6
hat6
windowmpsownslots6
oder6
something6
ein6
dein6
do6
refresh6
im6
diese6
sind5
men39s5
diesen5
wochen5
jetzt5
gerte4
motor4
essen4
solltest4
fitness4
podcast4
dir4
gegen4
14
apple4
24
einen4
um4
financial4
schimpfen4
hier4
sie4
richtig4
kinder4
erziehst4
durch4
bosse4
vater4
beziehung4
sex4
zum3
er3
nach3
callidxspsec33
bungen3
callidxspsec23
dem3
geht3
deinen3
care3
co3
gmbh3
presse3
33
gewinnspiele3
watch3
canvas-sneaker3
behandlung3
unsere3
trainingsplan3
von3
carb3
ber3
spricht3
axel3
consoledebugerror3
43
ob3
wir3
mehr3
msli3
frhstck3
tcfapiaddeventlistener3
tcdatatcstring3
error3
plan3
individueller3
muss3
initial3
disable3
resp3
metatag3
googletagenableservices3
300x245settargetingtagname3
jsonparse3002453
googletagdefineslot1057534menshealthdermp3
googletagcmdpushfunction3
callidxspsec13
function3
rest3
ruumlcken3
ausschalten3
nur3
rcken3
ab3
fitness-ernhrung3
wirken3
muskulser3
world3
love3
style3
life3
food3
newsletter3
dad3
angeboten3
erfolgen3
pfvtwonorefresh3
catch3
ourself3
gelaufen3
schief3
consoleloghier3
cmpuishown3
tcdatalistenerid3
good3
oh3
tcfapiremoveeventlistener3
once3
than3
more3
called3
get3
not3
remove3
alternativ3
true3
useractioncomplete3
tcloaded3
try3
tcdata3
abfragen3
api3
googletagpubadsisinitialloaddisabled3
gesetzt3
automatisch3
wird3
disableinitialload3
vorliegendem3
neu3
kg3

Who hosts Menshealth.de?

Menshealth.de Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:nginx

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6445%
GOOGLE
14.1050%
AS-26496-GO-DADDY-COM-LLC
3.4726%
NAMECHEAP-NET
3.1524%
AMAZON-AES
2.2226%
GoDaddy.com, LLC
2.0265%
UNIFIEDLAYER-AS-1
1.9734%
Fara Negar Pardaz Khuzestan
1.6251%
CONFLUENCE-NETWORK-INC
1.4696%
AMAZON-02
1.3660%

Menshealth.de Domain Nameserver Information

HostIP AddressCountry
ns-1407.awsdns-47.org 205.251.197.127
ns-1746.awsdns-26.co.uk 205.251.198.210
ns-44.awsdns-05.com 205.251.192.44
ns-850.awsdns-42.net 205.251.195.82

Websites with Similar Names

Mensh.mobi
mensh.mobi - Registered at Namecheap.com
Mensha.wang
click.com.cn
Menshabits.com
MensHabits.com
Menshacker.com
パパ活アプリ比較 | メンズハッカー
Menshafsoft.com
Login | Menshaf EYECARE

Recently Updated Websites

Opa-acai.com (7 seconds ago.)360hjs.com (8 seconds ago.)Cherishub.com (12 seconds ago.)Winningeleven-games.com (16 seconds ago.)Mysmileconcierge.com (17 seconds ago.)Womansay.net (17 seconds ago.)Dontquotemeradio.com (18 seconds ago.)Educratias.com (19 seconds ago.)Wu-kan.cn (21 seconds ago.)Us.webtoons.com (21 seconds ago.)Chambres-relaxation.com (21 seconds ago.)Phxhealthandfitness.com (22 seconds ago.)Bobbyallen.me (24 seconds ago.)Casebuzz.net (26 seconds ago.)Nosible.news (26 seconds ago.)Jreltour.org (26 seconds ago.)Rotanovs.com (28 seconds ago.)Facecol.com (29 seconds ago.)Gnos.in (30 seconds ago.)Sys.airtel.lv (30 seconds ago.)Legendaryonerealty.com (32 seconds ago.)Jeci.fr (35 seconds ago.)Baccoandcompany.com (36 seconds ago.)Xhhtc.com (36 seconds ago.)Finger.tidesec.com (37 seconds ago.)Triplescairns.com.au (37 seconds ago.)Catboys.com (38 seconds ago.)Blog.ericbmerritt.com (41 seconds ago.)Erikahaga.com (41 seconds ago.)Status.chocolatey.org (42 seconds ago.)

Recently Searched Keywords

winner one (1 second ago.)destei ablon (1 second ago.)saca (1 second ago.)kredyty gotowkowe ranking 2021 (1 second ago.)2016 categories (1 second ago.)barnwood (1 second ago.)unit1s 2d einheit1s (1 second ago.)信息公开受理 (1 second ago.)buy linkn n (2 seconds ago.)kings acres (2 seconds ago.)third person shooter switch (2 seconds ago.)30px 5px (2 seconds ago.)webopac (3 seconds ago.)regional anesthesia (4 seconds ago.)crm auto (4 seconds ago.)auld kendal golden unflavoured (4 seconds ago.)seo ppc (5 seconds ago.)nopirkt (5 seconds ago.)use the new (7 seconds ago.)俄语版 (7 seconds ago.)cch ly ti (7 seconds ago.)web banner (7 seconds ago.)no brasil e (8 seconds ago.)she was always (8 seconds ago.)uhr dooa workshop (8 seconds ago.)executive briefing (8 seconds ago.)dynamic-buttonhover (8 seconds ago.)hazr web (8 seconds ago.)she was always (8 seconds ago.)net organizasyon (9 seconds ago.)