MercadoCar | O Shopping de Autopeças | Brasil

Safety: Low trust score
Year Founded: 1997
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: Shopping

O shopping de autopeças MercadoCar é referência em acessórios e peças automotivas desde 1971. Atualmente, 7 lojas na Grande SP, oferecendo qualidade no atendimento e ampla variedade de produtos.



Domain summary

Last updated
2020-10-28
Domain label
mercadocar
Domain extension
com.br
Domain registered:
1997-11-17
Domain updated:
2020-10-13
Domain expires:
2020-11-17
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is mercadocar.com.br ranked relative to other sites:

Percentage of visits to mercadocar.com.br from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Mercadocar.com.br registered?
A: Mercadocar.com.br was registered 23 years, 4 months, 3 weeks, 4 days, 18 hours, 45 minutes, 18 seconds ago on Monday, November 17, 1997.
Q: When was the WHOIS for Mercadocar.com.br last updated?
A: The WHOIS entry was last updated 5 months, 4 weeks, 2 days, 18 hours, 45 minutes, 18 seconds ago on Tuesday, October 13, 2020.
Q: What are Mercadocar.com.br's nameservers?
A: DNS for Mercadocar.com.br is provided by the following nameservers:
  • e.sec.dns.br
  • f.sec.dns.br
Q: Who is the registrar for the Mercadocar.com.br domain?
A: The domain has been registered at BR-NIC.
Q: What is the traffic rank for Mercadocar.com.br?
A: Mercadocar.com.br has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Mercadocar.com.br each day?
A: Mercadocar.com.br receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Mercadocar.com.br resolve to?
A: Mercadocar.com.br resolves to the IPv4 address 23.236.62.147.
Q: In what country are Mercadocar.com.br servers located in?
A: Mercadocar.com.br has servers located in the United States.
Q: What webserver software does Mercadocar.com.br use?
A: Mercadocar.com.br is powered by webserver.
Q: Who hosts Mercadocar.com.br?
A: Mercadocar.com.br is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Mercadocar.com.br worth?
A: Mercadocar.com.br has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Mercadocar.com.br Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Mercadocar.com.br Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Mercadocar.com.br

H1 Headings

0 :

H2 Headings

17 :
  1. É tempo de ESTACIONAR 
  2. e FICAR EM CASA! 
  3. Veja os endereços
  4. de nossas 7 lojas
  5. O Shopping de Autopeças
  6. Conte com nossos serviços
  7. é rápido, prático e 100% seguro
  8. Serviços de Troca de óleo, instalação de acessórios, borracharia e lanternagem
  9. Somente realizamos serviços com os produtos comprados na loja.
  10. Troca de Óleo
  11. Lanternagem
  12. Borracharia
  13. Acessórios
  14. Loja Barra Funda 24Horas
  15. A qualquer hora,
  16. precisou? é 24h!
  17. Tudo em até 6x sem juros! 

H3 Headings

0 :

H4 Headings

2 :
  1. Lojas confortáveis com produtos estrategicamente posicionados para te atender com excelência.
  2. Venha para o Shopping de Autopeças​

H5 Headings

0 :

H6 Headings

1 :
  1. 11 2206-5000

Total IFRAMEs

3 :

Total Images

30 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

22:

Links - Internal (nofollow)

0:

Links - Outbound

6:

Links - Outbound (nofollow)

0:

Keyword Cloud for Mercadocar.com.br

no atendimentostylek91s5bt32itemselect borderradius0 webkitappearancenonemozappearancenonetransparentsem sair dofont8hstylejsz426t4labelwrapper255 255 1rgba53caminhes guarulhosultxtnew olborderstylesolidbordercolorrgba219 219backgroundtransparent64 01borderstylesolidbordercolorrgba255 6415px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserifdaswidth12pxpecas peca1borderstylesolidbordercolorrgba47 46 46stylejtstuaf4rightdirectionselectmozfocusring colortransparenttextshadow0santo andr santoborderwidth2pxbordercolorrgba204 204 204sexta64 64transitioncolor 04sparaguarulhos santopneupeas carro pneu0255 1boxsizingborderboxlubrificantes aditivos8h s 22hnsbadocolor2f2e2ee amplaneue helveticaneuew0155romaease 0s opacity0borderradius0marginleft calc100 243px10stylejtub841gnavcontainerarrow255 1borderradius0initialscale10 maximumscale10 userscalable0nameviewportcustomtruetypemetapropscontenttexthtmlhttpequivcontenttypecustomtruetypemetapropsnameclassificationcontentautobackgroundcolorrgba255 64 64olselect option8h s 20hdomingosguarulhosrgba0 08h s1 1pxp transitionopacitytextalignlastlefttextalignlastcenterpositionstaticboxshadow000produtostypemetapropsnamekeywordscontentautosexta dadinnextw01lightdinnextw02lightdinnextw10lightsansserif webkitappearancenonemozappearancenoneborderwidth1pxbackgroundcolortransparentbordersolid1pxcursorpointer5selectdatapreviewhovercarro46 46 122065000 peadinnextw01lightdinnextw02lightdinnextw10lightsansseriftextalignrightrodas calotas acessriosstylejqgbzj91textareaborderstylesolidbordercolorrgba249 249 24922hsbado dasultxtnewacessrios automotivo oleotextalignrightdirectionrtlpositionfixedselectfocusmsvalue backgroundtransparent1420hdomingos e feriadosopacity0 imagebutton1datastatepressedautopeas mercadocar refernciastylejsqfr2ndlabel8stylek9d99b1rbguserscalable0nameviewportcustomtruetypemetapropscontenttexthtmlhttpequivcontenttypecustomtruetypemetapropsnameclassificationcontentauto peascustomtruetypemetapropsnamedescriptioncontento shoppingcompre45pxcursorpointerpositionrelativemaxwidth100minwidth100minheight10pxheight100textoverflowellipsiswhitespacenowrapdisplayblockstylek91s5bt32menucontainerleftdirection136 204 1stylejsqfr2ndlabelwrappercalotas acessrios01borderstylesolidbordercolorrgba255 64backgroundcolorrgba204 204positionrelativeminheight25pxdisplaywebkitboxdisplaywebkitflexdisplayflexwebkitboxorientverticalwebkitboxdirectionnormalwebkitflexdirectioncolumnflexdirectioncolumn3pxdatacolor1 fillbateria pneupeaspneusatendimento e24hretire1colordbdbdbborderwidth1px borderstylesolidbordercolorrgba219importantcolor2f2e2eborderstylesolidbordercolorrgba47 46 46automotivas desde1backgroundcolorrgba255selectdatapreviewerror stylek91s5bt32menucontainerarrowpafter249 249 1backgroundcolorrgba255leostylek91s5bt32menucontainerrightdirectionstylejtstuaf4arrowsolido shoppingunidades sem255 10 0 06horriosmetakeywordsseopagetitleseopageuriseolojashidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypemetapropsnamedescriptioncontentaricanduva barra funda1colordbdbdbborderwidth1px borderstylesolidbordercolorrgba219 219204 204borderradius0 positionabsolutetop0right0bottom0left0transitionbordercolor 04s219 1desde 1971 atualmenteborderradius0stylek91s5bt32submenuwebkitappearancenonemozappearancenoneborderwidth1px backgroundcolorrgba255 255produtosmetakeywordsseopagetitleseopageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidn1gg6desktopbgmetadatapageidn1gg6ispresetfalseschemaversion10ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidn1gg6mobilebgmetadatapageidn1gg6ispresetfalseschemaversion10ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypescrollispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitemke39m4humetadatapageidn1gg6ispresetfalseschemaversion20ishiddenfalsetitleuri0816cc21a1064cd15f4160b3e12f6c3849774fmv2pngwidth400height400altcachemaxagehours1advancedseodatatagstypetitlechildrenmercadocarimportantdatacolor1 fill rgba53s 20hdomingosautopeas brasiltypemetapropsnamegooglesiteverificationcontentkcnqh6rqzzoezixe8hnwrkbsoiid0ht8bg6a6qaqlqcustomtruetypemetapropsnamegooglecontentnotranslatecustomtruetypemetapropscharsetutf8customtruetypemetapropsnamehandheldfriendlycontenttruecustomtruetypemetapropscontentwidthdevicewidth initialscale1016hsegundaseu oramentostylejtstuaf4arrowstylejtstuaf4centerdirectionandrmargin0lineheightnormalletterspacingnormalbarra fundatransitioncolorcolorrgba96neue helveticaneuew0155roma helveticaneuew0255romauserscalable0nameviewportcustomtruetypemetapropscontenttexthtmlhttpequivcontenttypecustomtruetypemetapropsnameclassificationcontentauto peascustomtruetypemetapropsnamedescriptioncontentostylek91s5bt32menucontainerarrow stylek91s5bt32menucontainersvgcontainerimagebutton1activeimagewidth100automotivasbackgroundcolorrgba47 46colorrgba96 94 940s opacity0borderradius0 displayinlineblockpositionabsoluteright0bottom100width140pxpadding10pxfontsize13pxlineheight16pxbackgroundfffboxshadow0sp oferecendo qualidade700 14px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserifleo lubrificantes aditivoslubrificantes aditivoscustomtruetypemetapropsnameabstractcontentecommercenormal 15px14emtextalignleft1px 1px0spelo telefone e04s ease 0shelveticapeae ampla variedadedinnextw01lightdinnextw02lightdinnextw10lightsansserif color605e5edinnextw01lightdinnextw02lightdinnextw10lightsansserif transitioncoloracessrios e peas204 1stylejtub841gnavcontainerarrowstylejtub841gnavcontainercenterdirectionhelveticaneuew0155roma helveticaneuew0255roma249 249selectdatapreviewerror stylejtstuaf4arrow06selectfocusmsvaluecontent colorrgba96colortransparenttextshadow0 04stylejsqagn2gimageitemlinkstylejt03rca8labelwrappermaximumscale10 userscalable0nameviewportcustomtruetypemetapropscontenttexthtmlhttpequivcontenttypecustomtruetypemetapropsnameclassificationcontentauto peascustomtruetypemetapropsnamedescriptioncontentorgba53 136 204stylek91s5bt32submenu stylek91s5bt32item17px14em16px14em05s ease 0sprodutosmetakeywordsseopagetitleseopageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidn1gg6desktopbgmetadatapageidn1gg6ispresetfalseschemaversion10ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidn1gg6mobilebgmetadatapageidn1gg6ispresetfalseschemaversion10ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypescrollispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitemke39m4humetadatapageidn1gg6ispresetfalseschemaversion20ishiddenfalsetitleuri0816cc21a1064cd15f4160b3e12f6c3849774fmv2pngwidth400height400altcachemaxagehours1advancedseodatatagstypetitlechildrenmercadocar o shoppingpelo telefonereferncialeo lubrificantesautooramento ou46 46mercadocartypemetapropsnamedescriptioncontentteleatendimento 11 22065000seu oramento ou204 1bordersolid rgba47stylejsz426t4labelos1bordercolorrgba471borderradius0selectmsexpand displaynonesppecas peca bateria8h s 20hndomingosmaispborderwidth1px backgroundcolorrgba255255 1boxsizingborderbox importantcolor2f2e2eborderstylesolidbordercolorrgba471px 3pxqualidademercadocar referncia emmotor1bordercolorrgba47 46borderstylek91s5bt32menucontainerarrowstylek91s5bt32item backgroundcolorrgba255 255shopping de autopeas000border0produtostypemetapropsnamekeywordscontentauto peascolor605e5ewordbreakbreakworddisplayinlineblocklineheight1referncia em acessriosstylek91s5bt32itemhoverareafirstchildborderradius0 fontnormal normalfont normalnossasright0webkitappearancenonemozappearancenoneborder0px solidstylek91s5bt32submenubefore11 22065000 peainitialscale10oldirrtlstylejtub841gnavcontainerarrowstylejtub841gnavcontainerrightdirectionguarulhos santo andrcolor605e5eatualmente 7 lojasseuease 0s backgroundcolornormal normal 17px14emvarfundanormal normalou compre pelovariedade204 204 1telefone22065000transitionopacity 05s ease01borderstylesolidbordercolorrgba255 64 64helveticaneuew1055romacarrometakeywordsseopagetitleseoteleatendimento mercadocarpageuriseoteleatendimentohidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypetitlechildrenteleatendimento mercadocartypemetapropsnamedescriptioncontentteleatendimento13atendimento219 219border 05s ease035 1pxcursorpointerborderstylesolidbordercolorrgba47 4604sstrc1inlinecontentlb1itemscontainer0 0rgba0 0 0positionabsolutetop0right0bottom0left0transitionbordercolor 04s1bordersolidnormal 17px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserif249 1backgroundcolorrgba2551borderstylesolidbordercolorrgba47stylejtstuaf4centerdirectionsair dolubrificantes aditivos televendascustomtruetypemetapropsnamecopyrightcontentmercadocarcustomtruetypemetapropsnameauthorcontentmercadocarcustomtruetypemetapropsnamecitycontentsofontnormal normalstylejsqagn2gimageitemzoom0 06sem umacalc100 243px 050 0 000contentshopping94 1255 255nossas unidadestelefone e980px 05e peas204 204 1bordersolids 20hndomingos epeca bateria pneupeasimagebutton1hoverimageferiados das 9hgeorgiapalatinobook antiquapalatino linotypeserifacessriosfont normal normal46 46 055domarginleft calc100 980pxtextalignlastleft15carrometakeywordsseopagetitleseoteleatendimento mercadocarpageuriseoteleatendimentohidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypetitlechildrenteleatendimento0 0 046 46 1bordercolorrgba47s 20hndomingostransitioncolor 04s easeacessrios efunda 24hwebkitappearancenonemozappearancenone fontnormal normalpeascustomtruetypemetapropsnamedescriptioncontento0s opacity0borderradius0mozappearancetextfieldwidth100santo andraditivos televendascustomtruetypemetapropsnamecopyrightcontentmercadocarcustomtruetypemetapropsnameauthorcontentmercadocarcustomtruetypemetapropsnamecitycontentsocolor ffffffauto peasstylek91s5bt32itemhoverarealastchild0s color 05s22hsbado das 8hborder 05sselectfocuspeas pecas pecaselectdatapreviewerror035backgroundcolorrgba160 160santo amaro tucuruvilojas naease 0s colorrgba47 46topautobottom001borderstylesolidbordercolorrgba255bateria pneupeas carrohelveticaneuew1055roma helvetica arialbackgroundcolorrgba1601 stylejtub841gnavcontainer64 1barraimagebutton1defaultimages 16hsegundaborderwidth2pxbordercolorrgba204 204stylejtub841gnavcontainersvgcontainers 22hsbado dasbackgroundcolor 04sauto peas carropafter contentpositionabsolutebottom12pxright10pxcolorffftextshadow0mercadocarpageuriseoteleatendimentohidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypetitlechildrenteleatendimento mercadocartypemetapropsnamedescriptioncontentteleatendimento 11borderstylesolidbordercolorrgba249 249backgroundcolorrgba255 255 255colorffffffhelveticaneuew0255roma helveticaneuew1055romastylek91s5bt32menucontainerarrowstylek91s5bt32menucontainerrightdirection14px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserifsp oferecendowebkitappearancenonemozappearancenoneborderwidth1pxamaro0 06borderradius0sair do carrometakeywordsseopagetitleseoteleatendimentohorriosmetakeywordsseopagetitleseopageuriseolojashidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypemetapropsnamedescriptioncontentaricanduva barrapecasdisplayinlineblockpositionabsoluteright0bottom100width140pxpadding10pxfontsize13pxlineheight16pxbackgroundfffboxshadow0 1pxifborderradius0 positionabsolutetop0right0bottom0left0transitionbordercolordas 8h stxtnew1 stylek91s5bt32menucontainerstylejt68laimlink1boxsizingborderbox0positionrelativewhitespacenowrapferiados dase retirepeas automotivas desdeamaro tucuruvi243px8h s 22hsbadostylejtzuc74iinputuserscalable0nameviewportcustomtruetypemetapropscontenttexthtmlhttpequivcontenttypecustomtruetypemetapropsnameclassificationcontentautopneupeas carroselectmsexpandrgba06grande sp oferecendoaditivoscustomtruetypemetapropsnameabstractcontentecommerce de autopositionabsolutetop0right0bottom0left0s 22hnsbado dasboxshadownonefunda 24h caminhesgrandedisplayinlineblockpositionabsoluteright0bottom100width140pxpadding10pxfontsize13pxlineheight16pxbackgroundfffboxshadow0 1px 3px055padding3pxmargin0maxwidth100webkitboxflex1webkitflex1flex1textoverflowellipsisbackgroundcolorrgba160 160 159mercadocar255 255 1borderradius0backgroundcolor ffffffbackgroundcolorrgba204 204 204normal 17px14emoferecendoselectdatapreviewerror stylejtub841gnavcontainerarrowcaminhestucuruvi consulte endereos9positionfixed importantleftauto importantzindex50qualidade no24h caminhes guarulhosandr santoe1605sp transitionopacity 05sstylejtoo8dvmbg062borderstylesolidbordercolorrgba47no atendimento eautomotivas desde 1971transitionopacity 05soleo motor leo3px rgba0antiquapalatinoborderwidth1px backgroundcolorrgba204fontnormal normal normalbrasiltypemetapropsnamegooglesiteverificationcontentkcnqh6rqzzoezixe8hnwrkbsoiid0ht8bg6a6qaqlqcustomtruetypemetapropsnamegooglecontentnotranslatecustomtruetypemetapropscharsetutf8customtruetypemetapropsnamehandheldfriendlycontenttruecustomtruetypemetapropscontentwidthdevicewidthmercadocar referncianeuentextaligninitialdisplayflexalignitemscenterborderwidth1px backgroundcolorrgba204 204borderstylesolidbordercolorrgba219importantcolor2f2e2eborderstylesolidbordercolorrgba47backgroundcolorrgba255 255normal 16px14emwebkitappearancenonemozappearancenone fontnormalcolor 05s easepositionstaticboxshadow000 0helvetica arialretire eme feriadosrodaspeas carro pneuborderstylesolidbordercolorrgba219 219 219fill rgba53 13622hnsbado dasconsultegeorgiapalatinobook antiquapalatinomotor leo lubrificantesoferecendo qualidade noe peas automotivasborderwidth1pxcarro pneu pneusdisplayinlineblockpositionabsoluteright0bottom100width140pxpadding10pxfontsize13pxlineheight16pxbackgroundfffboxshadow0das 8hoverflowhiddenstylek91s5bt32menucontainerarrowstylek91s5bt32menucontainerleftdirection1971 atualmente 7peas carro0s color255 255 1boxsizingborderbox0s backgroundcolor 04s2opacity0borderradius0 displayinlineblockpositionabsoluteright0bottom100width140pxpadding10pxfontsize13pxlineheight16pxbackgroundfffboxshadow0oramentoda 8hautomotivo oleo motorstylejqgbrc6yinput1borderstylesolidbordercolorrgba47 46carro pneubarra funda 24hstylejtub841gnavcontainerarrowstylejtub841gnavcontainerleftdirection255 255 1colordbdbdbborderwidth1pxmaximumscale10 userscalable0nameviewportcustomtruetypemetapropscontenttexthtmlhttpequivcontenttypecustomtruetypemetapropsnameclassificationcontentautobackgroundcolorrgba255243px 05204 062borderstylesolidbordercolorrgba47 46bateriaborder0pxpointereventsnonestylek91s5bt32menucontainerhelveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055romanormal 700desde20hdomingosfontnormalpeca bateria980pxstylek91s5bt32item backgroundcolorrgba255lubrificantes64 01borderstylesolidbordercolorrgba255stylejtub841gnavcontainercenterdirectioncalc100naffffffwiximagestylejsqfr2ndlink0s backgroundcolorunidadesda204 062borderstylesolidbordercolorrgba4720hndomingos esexta da 8hpneu pneus46 055padding3pxmargin0maxwidth100webkitboxflex1webkitflex1flex1textoverflowellipsissair1bordercolorrgba47 46 46s 20hdomingos epneuhelveticaneuew0255roma1pxcursorpointer important46 46 055padding3pxmargin0maxwidth100webkitboxflex1webkitflex1flex1textoverflowellipsissvgsvg datacolor1automotivoimportantleftauto importantzindex500 0 06borderradius0positionfixed importantleftautona grande spstylejtstuaf4svgcontainermargin0e retire emopacity1204 1bordersolidreferncia emrgba47peasautopeasbackgroundcolorrgba47 46 46ou compreselect borderradius0strc1dataresponsivestylek91s5bt32item borderradius0lojas94 94255 1colordbdbdbborderwidth1px borderstylesolidbordercolorrgba219rgba53 13604s easedisplaynonetxtnew ule horriosmetakeywordsseopagetitleseopageuriseolojashidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypemetapropsnamedescriptioncontentaricanduvatucuruviarial159 1borderstylesolidbordercolorrgba47 46borderwidth2px borderstylesolidbordercolorrgba249uma de nossaspneus rodas calotaspeas automotivasjustifycontentflexstartsemlojas na grande94 94 1pea seu oramentostylejtub841gnavcontainerarrow stylejtub841gnavcontainersvgcontainerdinnextw01lightdinnextw02lightdinnextw10lightsansserif color605e5ewordbreakbreakworddisplayinlineblocklineheight1sem sairbackgroundcolorrgba255 64stylejtstuaf4variedade de produtostypemetapropsnamekeywordscontentautopaulocustomtruetypemetapropsnamestatecontentsoleft10pxright10pxpeascustomtruetypemetapropsnamedescriptioncontento shoppingborderwidth2pxbordercolorrgba204horriosmetakeywordsseopagetitleseopageuriseolojashidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypemetapropsnamedescriptioncontentaricanduvagrande sp219 219 1nossas unidades sempea seucalotaslinotypeserif color2f2e2eamaro tucuruvi consulteb0b0b0na grandeferiadosda 8h squalidade no atendimentocolor 05s159 1borderstylesolidbordercolorrgba47compre pelo telefone055antiquapalatino linotypeserifaditivostucuruvi consulte1px 0positionrelativewhitespacenowrap160 159 1borderstylesolidbordercolorrgba47andr santo amarogeorgiapalatinobook204 204 062borderstylesolidbordercolorrgba47backgroundcolorautopeas mercadocarborderwidth2px46 1bordercolorrgba477santoleo lubrificantes aditivoscustomtruetypemetapropsnameabstractcontentecommerce1971 atualmente20hndomingos16hsegunda a sextanormal 700 14px14embrasiltypemetapropsnamegooglesiteverificationcontentkcnqh6rqzzoezixe8hnwrkbsoiid0ht8bg6a6qaqlqcustomtruetypemetapropsnamegooglecontentnotranslatecustomtruetypemetapropscharsetutf8customtruetypemetapropsnamehandheldfriendlycontenttruecustomtruetypemetapropscontentwidthdevicewidth initialscale10oramento ou compreoaditivoscustomtruetypemetapropsnameabstractcontentecommerceconsulte endereos eendereos esolid transparent17px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserif1px 3px rgba0margin0lineheightnormalletterspacingnormal txtnew062borderstylesolidbordercolorrgba47 46 46contentpositionabsolutebottom12pxright10pxcolorffftextshadow0 1px 3px1backgroundcolorrgba255 255 255backgroundcolorrgba204255 1 stylejtub841gnavcontainers 22hnsbado311calc100 980px1backgroundcolorrgba255 255ease 0sease 0s borderrodas calotasstylek9da67lvinputstylejtub841gnavcontainere feriados das0pxstylejt03rca8link06borderradius0compre pelonormal 15px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserif9h sdinnextw01lightdinnextw02lightdinnextw10lightsansserif webkitappearancenonemozappearancenoneborderwidth1px backgroundcolorrgba255backgroundcolor 04s easepneus rodasstylejtstuaf4leftdirection1bordersolid rgba47umastylejt68laimlabelstylejtstuaf4arrowstylejtstuaf4leftdirectionsolid rgba47colorsolid rgba47 46positionstaticboxshadow000 0 01colordbdbdbborderwidth1pxselectmozfocusring46 055helveticaneuew0255roma helveticaneuew1055roma helveticastylejt68laimlabelwrappercalotas acessrios automotivosanto amaromercadocartypemetapropsnamedescriptioncontentteleatendimento 11marginleft calc100opacity0borderradius0 displayinlineblockpositionabsoluteright0bottom100width140pxpadding10pxfontsize13pxlineheight16pxbackgroundfffboxshadow0 1pxvariedade de produtosmetakeywordsseopagetitleseopageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidn1gg6desktopbgmetadatapageidn1gg6ispresetfalseschemaversion10ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidn1gg6mobilebgmetadatapageidn1gg6ispresetfalseschemaversion10ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypescrollispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitemke39m4humetadatapageidn1gg6ispresetfalseschemaversion20ishiddenfalsetitleuri0816cc21a1064cd15f4160b3e12f6c3849774fmv2pngwidth400height400altcachemaxagehours1advancedseodatatagstypetitlechildrenmercadocarcontentpositionabsolutebottom12pxright10pxcolorffftextshadow0 1px136 20422hsbadoatualmente 7255 1colordbdbdbborderwidth1pxhelveticaneuew0155romacolorrgba96 94webkitappearancenonemozappearancenoneborderwidth1px backgroundcolorrgba255stylejtub841gnavcontainerrightdirectionfill20hndomingos e feriadostextoverflowellipsiswhitespacenowrapoverflowhiddencolor44474dbackgroundcolorffffff1boxsizingborderbox importantcolor2f2e2eborderstylesolidbordercolorrgba47 4646 1bordercolorrgba47 46atualmentetelevendascustomtruetypemetapropsnamecopyrightcontentmercadocarcustomtruetypemetapropsnameauthorcontentmercadocarcustomtruetypemetapropsnamecitycontentsopecastylek91s5bt32menucontainersvgcontainercontentpositionabsolutebottom12pxright10pxcolorffftextshadow046 1 1pxnodas 9himportantcolor2f2e2eborderstylesolidbordercolorrgba47 46imagebutton1datastatehovered05s easeinitialscale10 maximumscale10produtosmetakeywordsseopagetitleseopageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidn1gg6desktopbgmetadatapageidn1gg6ispresetfalseschemaversion10ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidn1gg6mobilebgmetadatapageidn1gg6ispresetfalseschemaversion10ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypescrollispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitemke39m4humetadatapageidn1gg6ispresetfalseschemaversion20ishiddenfalsetitleuri0816cc21a1064cd15f4160b3e12f6c3849774fmv2pngwidth400height400altcachemaxagehours1advancedseodatatagstypetitlechildrenmercadocar oacessrios automotivopositionabsolutetop0left0color373737width100height100normal normal 15px14ematendimento e ampla1boxsizingborderbox importantcolor2f2e2eborderstylesolidbordercolorrgba47700 14px14em1pxborderwidth1px backgroundcolorrgba160 160ampladas 9h sborderradius0 webkitappearancenonemozappearancenonetextaligncenterampla variedadeimagebutton1datastatepressed0515px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserif webkitappearancenonemozappearancenoneborderwidth1pxmotor leotelefone e retireborderstylesolidbordercolorrgba2493px rgba0 0produtostypemetapropsnamekeywordscontentauto peas pecasstylejtstuaf4arrowstylejtstuaf4rightdirectiontextalignlastrightdirectionrtlpositionabsolutetop0right0bottom0left0transitionbordercoloropacity0borderradius022065000 pea seujustifycontentcenterdo carrometakeywordsseopagetitleseoteleatendimentomercadocarpageuriseoteleatendimentohidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypetitlechildrenteleatendimento24h caminhes12normal062borderstylesolidbordercolorrgba47 46do carrometakeywordsseopagetitleseoteleatendimento mercadocarpageuriseoteleatendimentohidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypetitlechildrenteleatendimento9h s 16hsegundas 22hsbadocolortransparenttextshadow0oleoborderstylesolidbordercolorrgba47borderright0importantleftautoborderwidth1px backgroundcolorrgba1607 lojas naeasestylejtstuaf4arrow stylejtstuaf4svgcontainerselectdatapreviewfocuspneupeasoferecendo qualidade11 22065000retire em umauldatacolor1pafter contentpositionabsolutebottom12pxright10pxcolorffftextshadow0 1px1px 1px 0positionrelativewhitespacenowrapol ul0s borderpositionabsolutetop0right0bottom0left0transitionbordercolor 04s easecalc100 243pxborderstylesolidbordercolorrgba47 46 46linotypeseriffill rgba53pelo46 1249 1backgroundcolorrgba255 255svg datacolor1 fillnormal normal 16px14emborderradius0 fontnormalstylek91s5bt32labelimportantzindex50emselectnotdatapreviewfocusinvalidou22hnsbadoautopeas brasiltypemetapropsnamegooglesiteverificationcontentkcnqh6rqzzoezixe8hnwrkbsoiid0ht8bg6a6qaqlqcustomtruetypemetapropsnamegooglecontentnotranslatecustomtruetypemetapropscharsetutf8customtruetypemetapropsnamehandheldfriendlycontenttruecustomtruetypemetapropscontentwidthdevicewidthcolortransparenttextshadow0 0 0035 1pxcursorpointer importantantiquapalatino linotypeserif color2f2e2epeas pecasmercadocarpageuriseoteleatendimentohidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypetitlechildrenteleatendimento mercadocartypemetapropsnamedescriptioncontentteleatendimentoendereosoptionoleo motorrgba47 46 46content colorrgba96 94consulte endereospneu pneus rodasstylejtub841grepeaterbuttonlabelbrasiltypemetapropsnamegooglesiteverificationcontentkcnqh6rqzzoezixe8hnwrkbsoiid0ht8bg6a6qaqlqcustomtruetypemetapropsnamegooglecontentnotranslatecustomtruetypemetapropscharsetutf8customtruetypemetapropsnamehandheldfriendlycontenttruecustomtruetypemetapropscontentwidthdevicewidth initialscale10 maximumscale10stylejt03rca8labeldisplaywebkitboxdisplaywebkitflexdisplayflexwebkitboxorientverticalwebkitboxdirectionnormalwebkitflexdirectioncolumnflexdirectioncolumn160 159em acessriosstylek91s5bt32menucontainerarrowstylek91s5bt32menucontainercenterdirectiontransitionopacityselectmozfocusring colortransparenttextshadow0 0televendascustomtruetypemetapropsnamecopyrightcontentmercadocarcustomtruetypemetapropsnameauthorcontentmercadocarcustomtruetypemetapropsnamecitycontentso paulocustomtruetypemetapropsnamestatecontentso64 64 01borderstylesolidbordercolorrgba255selectdataerrortruebackgroundcolorrgba47select1bordersolid rgba47 46select option textoverflowellipsiswhitespacenowrapoverflowhiddencolor44474dbackgroundcolorffffffborderradius0 webkitappearancenonemozappearancenone fontnormal7 lojas22hnsbado das 8hoption textoverflowellipsiswhitespacenowrapoverflowhiddencolor44474dbackgroundcolorffffffborderwidth1px backgroundcolorrgba255 64em acessrios e14px14emnormal normal normal15px14em dinnextw01lightdinnextw02lightdinnextw10lightsansserif color605e5ewordbreakbreakworddisplayinlineblocklineheight10s border 05s20hdomingos ejustifycontentflexendhelveticaneuew1055roma helveticacarrometakeywordsseopagetitleseoteleatendimentounidades sem sairmaximumscale10wiximage positionabsolutetop0right0bottom0left015px14emstylejtub841gnavcontainerleftdirectionmercadocartypemetapropsnamedescriptioncontentteleatendimentoe horriosmetakeywordsseopagetitleseopageuriseolojashidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypemetapropsnamedescriptioncontentaricanduva barraopacity0caminhes guarulhos santoendereos e horriosmetakeywordsseopagetitleseopageuriseolojashidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypemetapropsnamedescriptioncontentaricanduvadesde 1971calc100 980px 05stylek91s5bt32menucontainercenterdirection64 64 1automotivo oleo0 000stylejsz426t4linkdinnextw01lightdinnextw02lightdinnextw10lightsansserif transitioncolor 04sborderwidth2px borderstylesolidbordercolorrgba249 2499h1aditivos televendascustomtruetypemetapropsnamecopyrightcontentmercadocarcustomtruetypemetapropsnameauthorcontentmercadocarcustomtruetypemetapropsnamecitycontentso paulocustomtruetypemetapropsnamestatecontentsoborderleft0selecthover255 1 stylek91s5bt32menucontainermarginleft

Longtail Keyword Density for Mercadocar.com.br

KeywordsOccurences
margin-left calc100 980px58
calc100 980px 0558
fontnormal normal normal20
04s ease 0s19
normal normal 15px14em18
normal 15px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif18
das 8h s16
background-colorrgba255 255 25515
rgba47 46 4615
barra funda 24h15
funda 24h caminhes15
santo andr santo14
guarulhos santo andr14
caminhes guarulhos santo14
santo amaro tucuruvi14
shopping de autopeas14
andr santo amaro14
24h caminhes guarulhos14
e feriados das14
consulte endereos e14
tucuruvi consulte endereos14
amaro tucuruvi consulte14
background-colorrgba204 204 20413
255 255 112
das 9h s12
sexta da 8h12
46 46 05512
feriados das 9h12
da 8h s12
46 46 111
05s ease 0s11
font normal normal10
1background-colorrgba255 255 2559
normal normal normal9
01border-stylesolidborder-colorrgba255 64 648
64 64 01border-stylesolidborder-colorrgba2558
64 01border-stylesolidborder-colorrgba255 648
204 062border-stylesolidborder-colorrgba47 468
background-colorrgba255 64 648
border-width1px background-colorrgba255 648
062border-stylesolidborder-colorrgba47 46 468
204 204 062border-stylesolidborder-colorrgba478
64 64 18
e peas automotivas8
acessrios e peas8
em acessrios e8
referncia em acessrios8
mercadocar referncia em8
autopeas mercadocar referncia8
204 204 18
border-width2px border-stylesolidborder-colorrgba249 2498
border-stylesolidborder-colorrgba249 249 2498
249 249 1background-colorrgba2558
249 1background-colorrgba255 2558
border-width1px background-colorrgba204 2048
automotivas desde 19718
peas automotivas desde8
carro pneu pneus8
pneus rodas calotas8
rodas calotas acessrios8
calotas acessrios automotivo8
acessrios automotivo oleo8
automotivo oleo motor8
oleo motor leo8
motor leo lubrificantes8
e ampla variedade8
atendimento e ampla8
no atendimento e8
qualidade no atendimento8
oferecendo qualidade no8
sp oferecendo qualidade8
grande sp oferecendo8
na grande sp8
lojas na grande8
7 lojas na8
atualmente 7 lojas8
1971 atualmente 78
desde 1971 atualmente8
pneu pneus rodas8
horriosmetakeywordsseopagetitleseopageuriseolojashidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypemetapropsnamedescriptioncontentaricanduva barra funda7
positionstaticbox-shadow000 0 07
e horriosmetakeywordsseopagetitleseopageuriseolojashidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypemetapropsnamedescriptioncontentaricanduva barra7
endereos e horriosmetakeywordsseopagetitleseopageuriseolojashidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypemetapropsnamedescriptioncontentaricanduva7
rgba0 0 07
compre pelo telefone6
retire em uma6
margin-left calc100 243px6
border-width2pxborder-colorrgba204 204 2046
calc100 243px 056
sem sair do6
unidades sem sair6
nossas unidades sem6
uma de nossas6
e retire em6
ou compre pelo6
1px 3px rgba06
3px rgba0 06
telefone e retire6
11 2206-5000 pea6
2206-5000 pea seu6
pea seu oramento6
seu oramento ou6
oramento ou compre6
pelo telefone e6
antiquapalatino linotypeserif color2f2e2e5
9h s 16hsegunda5
georgiapalatinobook antiquapalatino linotypeserif5
colorrgba96 94 945
content colorrgba96 945
15px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif color605e5eword-breakbreak-worddisplayinline-blockline-height15
solid rgba47 465
0 0 05
1bordersolid rgba47 465
8h s 22hnsbado4
pneupeas carro pneu4
lubrificantes aditivos televendascustomtruetypemetapropsnamecopyrightcontentmercadocarcustomtruetypemetapropsnameauthorcontentmercadocarcustomtruetypemetapropsnamecitycontentso4
leo lubrificantes aditivos4
peas carro pneu4
auto peas carro4
aditivoscustomtruetypemetapropsnameabstractcontentecommerce de auto4
leo lubrificantes aditivoscustomtruetypemetapropsnameabstractcontentecommerce4
peca bateria pneupeas4
bateria pneupeas carro4
s 22hnsbado das4
pecas peca bateria4
peas pecas peca4
initial-scale10 maximum-scale10 user-scalable0nameviewportcustomtruetypemetapropscontenttexthtmlhttp-equivcontent-typecustomtruetypemetapropsnameclassificationcontentauto4
s 20hdomingos e4
20hndomingos e feriados4
s 20hndomingos e4
8h s 20hndomingos4
22hnsbado das 8h4
20hdomingos e feriados4
helveticaneuew10-55roma helvetica arial4
8h s 20hdomingos4
255 255 1box-sizingborder-box4
1colordbdbdbborder-width1px border-stylesolidborder-colorrgba219 2194
255 1colordbdbdbborder-width1px border-stylesolidborder-colorrgba2194
255 255 1colordbdbdbborder-width1px4
22hsbado das 8h4
1border-stylesolidborder-colorrgba47 46 464
159 1border-stylesolidborder-colorrgba47 464
160 159 1border-stylesolidborder-colorrgba474
background-colorrgba160 160 1594
border-width1px background-colorrgba160 1604
border-radius0 fontnormal normal4
219 219 14
204 1bordersolid rgba474
204 204 1bordersolid4
background-colorrgba47 46 464
transitioncolor 04s ease4
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif transitioncolor 04s4
background-color 04s ease4
0s background-color 04s4
ease 0s background-color4
positionabsolutetop0right0bottom0left0transitionborder-color 04s ease4
border-radius0 positionabsolutetop0right0bottom0left0transitionborder-color 04s4
border-stylesolidborder-colorrgba219 219 2194
aditivos televendascustomtruetypemetapropsnamecopyrightcontentmercadocarcustomtruetypemetapropsnameauthorcontentmercadocarcustomtruetypemetapropsnamecitycontentso paulocustomtruetypemetapropsnamestatecontentso4
255 1 style-k91s5bt32menucontainer4
border-stylesolidborder-colorrgba47 46 464
16hsegunda a sexta4
helveticaneuew02-55roma helveticaneuew10-55roma helvetica4
s 22hsbado das4
8h s 22hsbado4
neue helveticaneuew01-55roma helveticaneuew02-55roma4
255 1 style-jtub841gnavcontainer4
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma4
produtosmetakeywordsseopagetitleseopageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidn1gg6desktopbgmetadatapageidn1gg6ispresetfalseschemaversion10ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidn1gg6mobilebgmetadatapageidn1gg6ispresetfalseschemaversion10ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypescrollispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitem-ke39m4humetadatapageidn1gg6ispresetfalseschemaversion20ishiddenfalsetitleuri0816cc21a1064cd15f4160b3e12f6c3849774fmv2pngwidth400height400altcachemaxagehours1advancedseodatatagstypetitlechildrenmercadocar o shopping3
variedade de produtosmetakeywordsseopagetitleseopageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidn1gg6desktopbgmetadatapageidn1gg6ispresetfalseschemaversion10ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidn1gg6mobilebgmetadatapageidn1gg6ispresetfalseschemaversion10ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypescrollispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitem-ke39m4humetadatapageidn1gg6ispresetfalseschemaversion20ishiddenfalsetitleuri0816cc21a1064cd15f4160b3e12f6c3849774fmv2pngwidth400height400altcachemaxagehours1advancedseodatatagstypetitlechildrenmercadocar3
94 94 13
autopeas brasiltypemetapropsnamegoogle-site-verificationcontentkcnqh6rqzzoezixe8hnwrkbsoiid0ht8bg6a6qaqlqcustomtruetypemetapropsnamegooglecontentnotranslatecustomtruetypemetapropscharsetutf-8customtruetypemetapropsnamehandheldfriendlycontenttruecustomtruetypemetapropscontentwidthdevice-width initial-scale103
brasiltypemetapropsnamegoogle-site-verificationcontentkcnqh6rqzzoezixe8hnwrkbsoiid0ht8bg6a6qaqlqcustomtruetypemetapropsnamegooglecontentnotranslatecustomtruetypemetapropscharsetutf-8customtruetypemetapropsnamehandheldfriendlycontenttruecustomtruetypemetapropscontentwidthdevice-width initial-scale10 maximum-scale103
46 1 1px3
maximum-scale10 user-scalable0nameviewportcustomtruetypemetapropscontenttexthtmlhttp-equivcontent-typecustomtruetypemetapropsnameclassificationcontentauto peascustomtruetypemetapropsnamedescriptioncontento3
user-scalable0nameviewportcustomtruetypemetapropscontenttexthtmlhttp-equivcontent-typecustomtruetypemetapropsnameclassificationcontentauto peascustomtruetypemetapropsnamedescriptioncontento shopping3
variedade de produtostypemetapropsnamekeywordscontentauto3
produtostypemetapropsnamekeywordscontentauto peas pecas3
46 46 1border-colorrgba473
1border-colorrgba47 46 463
46 1border-colorrgba47 463
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif -webkit-appearancenone-moz-appearancenoneborder-width1px background-colorrgba2553
svg data-color1 fill3
035 1pxcursorpointer important3
1px 1px 0positionrelativewhite-spacenowrap3
data-color1 fill rgba533
fill rgba53 1363
rgba53 136 2043
136 204 13
255 255 1border-radius03
positionfixed importantleftauto importantz-index503
normal 17px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif3
normal normal 17px14em3
normal normal 16px14em3
15px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif -webkit-appearancenone-moz-appearancenoneborder-width1px3
normal 700 14px14em3
-webkit-appearancenone-moz-appearancenoneborder-width1px background-colorrgba255 2553
displayinline-blockpositionabsoluteright0bottom100width140pxpadding10pxfont-size13pxline-height16pxbackgroundfffbox-shadow0 1px 3px3
sair do carrometakeywordsseopagetitleseoteleatendimento3
0s color 05s3
color 05s ease3
ease 0s opacity0border-radius03
0s opacity0border-radius0 displayinline-blockpositionabsoluteright0bottom100width140pxpadding10pxfont-size13pxline-height16pxbackgroundfffbox-shadow03
opacity0border-radius0 displayinline-blockpositionabsoluteright0bottom100width140pxpadding10pxfont-size13pxline-height16pxbackgroundfffbox-shadow0 1px3
0 0 063
carrometakeywordsseopagetitleseoteleatendimento mercadocarpageuriseoteleatendimentohidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypetitlechildrenteleatendimento mercadocartypemetapropsnamedescriptioncontentteleatendimento3
pafter contentpositionabsolutebottom-12pxright10pxcolorffftext-shadow0 1px3
contentpositionabsolutebottom-12pxright10pxcolorffftext-shadow0 1px 3px3
0 0 06border-radius03
-webkit-appearancenone-moz-appearancenone fontnormal normal3
border-radius0 -webkit-appearancenone-moz-appearancenone fontnormal3
select border-radius0 -webkit-appearancenone-moz-appearancenone3
do carrometakeywordsseopagetitleseoteleatendimento mercadocarpageuriseoteleatendimentohidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypetitlechildrenteleatendimento3
mercadocarpageuriseoteleatendimentohidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypetitlechildrenteleatendimento mercadocartypemetapropsnamedescriptioncontentteleatendimento 113
700 14px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif3
colortransparenttext-shadow0 0 03
255 1box-sizingborder-box importantcolor2f2e2eborder-stylesolidborder-colorrgba473
1box-sizingborder-box importantcolor2f2e2eborder-stylesolidborder-colorrgba47 463
importantcolor2f2e2eborder-stylesolidborder-colorrgba47 46 463
46 46 055padding3pxmargin0max-width100-webkit-box-flex1-webkit-flex1flex1text-overflowellipsis3
style-k91s5bt32item background-colorrgba255 2553
0 0 0003
select-moz-focusring colortransparenttext-shadow0 03
mercadocartypemetapropsnamedescriptioncontentteleatendimento 11 2206-50003
p transitionopacity 05s3
transitionopacity 05s ease3
ease 0s border3
select option text-overflowellipsiswhite-spacenowrapoverflowhiddencolor44474dbackground-colorffffff3
border 05s ease3
ease 0s color3
0s border 05s3
margin-left calc10066
980px 0558
calc100 980px58
46 4643
normal normal40
255 25533
ease 0s31
204 20429
0 029
8h s28
fontnormal normal21
64 6420
04s ease20
15px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif18
normal 15px14em18
barra funda16
das 8h16
santo andr15
santo amaro15
background-colorrgba255 25515
funda 24h15
24h caminhes15
rgba47 4615
endereos e14
caminhes guarulhos14
guarulhos santo14
andr santo14
feriados das14
amaro tucuruvi14
e feriados14
tucuruvi consulte14
consulte endereos14
background-colorrgba204 20413
255 112
da 8h12
das 9h12
9h s12
46 05512
sexta da12
204 111
05s ease11
46 111
font normal10
1background-colorrgba255 2559
acessrios e8
em acessrios8
referncia em8
border-width1px background-colorrgba2048
204 062border-stylesolidborder-colorrgba478
062border-stylesolidborder-colorrgba47 468
border-width1px background-colorrgba2558
border-width2px border-stylesolidborder-colorrgba2498
border-stylesolidborder-colorrgba249 2498
peas automotivas8
249 1background-colorrgba2558
64 01border-stylesolidborder-colorrgba2558
01border-stylesolidborder-colorrgba255 648
64 18
mercadocar referncia8
autopeas mercadocar8
249 2498
e peas8
background-colorrgba255 648
automotivas desde8
atendimento e8
leo lubrificantes8
motor leo8
oleo motor8
automotivo oleo8
acessrios automotivo8
calotas acessrios8
rodas calotas8
pneus rodas8
pneu pneus8
carro pneu8
desde 19718
e ampla8
ampla variedade8
no atendimento8
oferecendo qualidade8
1971 atualmente8
atualmente 78
7 lojas8
lojas na8
na grande8
94 948
grande sp8
sp oferecendo8
qualidade no8
rgba0 07
margin0line-heightnormalletter-spacingnormal txtnew7
positionstaticbox-shadow000 07
e horriosmetakeywordsseopagetitleseopageuriseolojashidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypemetapropsnamedescriptioncontentaricanduva7
horriosmetakeywordsseopagetitleseopageuriseolojashidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypemetapropsnamedescriptioncontentaricanduva barra7
oramento ou6
em uma6
telefone e6
3px rgba06
1px 3px6
e retire6
seu oramento6
border-width2pxborder-colorrgba204 2046
nossas unidades6
compre pelo6
unidades sem6
o shopping6
sem sair6
243px 056
calc100 243px6
sair do6
pelo telefone6
retire em6
11 2206-50006
pea seu6
2206-5000 pea6
ou compre6
solid rgba475
linotypeserif color2f2e2e5
1bordersolid rgba475
160 1595
s 16hsegunda5
1 style-k91s5bt32menucontainer5
1 style-jtub841gnavcontainer5
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif color605e5eword-breakbreak-worddisplayinline-blockline-height15
content colorrgba965
georgiapalatinobook antiquapalatino5
antiquapalatino linotypeserif5
colorrgba96 945
peca bateria4
aditivos televendascustomtruetypemetapropsnamecopyrightcontentmercadocarcustomtruetypemetapropsnameauthorcontentmercadocarcustomtruetypemetapropsnamecitycontentso4
lubrificantes aditivos4
peas carro4
auto peas4
lubrificantes aditivoscustomtruetypemetapropsnameabstractcontentecommerce4
bateria pneupeas4
pneupeas carro4
pecas peca4
peas pecas4
s 22hsbado4
22hsbado das4
s 20hdomingos4
20hdomingos e4
maximum-scale10 user-scalable0nameviewportcustomtruetypemetapropscontenttexthtmlhttp-equivcontent-typecustomtruetypemetapropsnameclassificationcontentauto4
initial-scale10 maximum-scale104
22hnsbado das4
s 20hndomingos4
20hndomingos e4
s 22hnsbado4
televendascustomtruetypemetapropsnamecopyrightcontentmercadocarcustomtruetypemetapropsnameauthorcontentmercadocarcustomtruetypemetapropsnamecitycontentso paulocustomtruetypemetapropsnamestatecontentso4
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif transitioncolor4
positionabsolutetop0right0bottom0left0transitionborder-color 04s4
border-radius0 fontnormal4
transitioncolor 04s4
txtnew ul4
204 1bordersolid4
background-colorrgba47 464
border-radius0 positionabsolutetop0right0bottom0left0transitionborder-color4
0s background-color4
1colordbdbdbborder-width1px border-stylesolidborder-colorrgba2194
background-color 04s4
255 1box-sizingborder-box4
normal 7004
255 1colordbdbdbborder-width1px4
219 14
219 2194
1border-stylesolidborder-colorrgba47 464
159 1border-stylesolidborder-colorrgba474
border-stylesolidborder-colorrgba47 464
background-color ffffff4
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif color605e5e4
border-width1px background-colorrgba1604
helvetica arial4
helveticaneuew10-55roma helvetica4
helveticaneuew02-55roma helveticaneuew10-55roma4
helveticaneuew01-55roma helveticaneuew02-55roma4
neue helveticaneuew01-55roma4
background-colorrgba160 1604
14px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif4
style-k91s5bt32submenu style-k91s5bt32item4
color ffffff4
solid transparent4
style-k91s5bt32item border-radius04
border-stylesolidborder-colorrgba219 2194
1pxcursorpointer important3
035 1pxcursorpointer3
94 13
46 1border-colorrgba473
1border-colorrgba47 463
1 1px3
produtosmetakeywordsseopagetitleseopageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidn1gg6desktopbgmetadatapageidn1gg6ispresetfalseschemaversion10ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidn1gg6mobilebgmetadatapageidn1gg6ispresetfalseschemaversion10ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypescrollispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitem-ke39m4humetadatapageidn1gg6ispresetfalseschemaversion20ishiddenfalsetitleuri0816cc21a1064cd15f4160b3e12f6c3849774fmv2pngwidth400height400altcachemaxagehours1advancedseodatatagstypetitlechildrenmercadocar o3
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif -webkit-appearancenone-moz-appearancenoneborder-width1px3
1px 0positionrelativewhite-spacenowrap3
136 2043
autopeas brasiltypemetapropsnamegoogle-site-verificationcontentkcnqh6rqzzoezixe8hnwrkbsoiid0ht8bg6a6qaqlqcustomtruetypemetapropsnamegooglecontentnotranslatecustomtruetypemetapropscharsetutf-8customtruetypemetapropsnamehandheldfriendlycontenttruecustomtruetypemetapropscontentwidthdevice-width3
255 1border-radius03
normal 16px14em3
normal 17px14em3
17px14em din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif3
positionfixed importantleftauto3
importantleftauto importantz-index503
border0px solid3
ultxtnew ol3
brasiltypemetapropsnamegoogle-site-verificationcontentkcnqh6rqzzoezixe8hnwrkbsoiid0ht8bg6a6qaqlqcustomtruetypemetapropsnamegooglecontentnotranslatecustomtruetypemetapropscharsetutf-8customtruetypemetapropsnamehandheldfriendlycontenttruecustomtruetypemetapropscontentwidthdevice-width initial-scale103
ol ul3
opacity0 imagebutton1data-statepressed3
produtostypemetapropsnamekeywordscontentauto peas3
peascustomtruetypemetapropsnamedescriptioncontento shopping3
user-scalable0nameviewportcustomtruetypemetapropscontenttexthtmlhttp-equivcontent-typecustomtruetypemetapropsnameclassificationcontentauto peascustomtruetypemetapropsnamedescriptioncontento3
1px 1px3
-webkit-appearancenone-moz-appearancenoneborder-width1px background-colorrgba2553
mercadocartypemetapropsnamedescriptioncontentteleatendimento 113
1box-sizingborder-box importantcolor2f2e2eborder-stylesolidborder-colorrgba473
selectfocus-ms-value backgroundtransparent3
-webkit-appearancenone-moz-appearancenone fontnormal3
select option3
option text-overflowellipsiswhite-spacenowrapoverflowhiddencolor44474dbackground-colorffffff3
select-moz-focusring colortransparenttext-shadow03
colortransparenttext-shadow0 03
0 0003
select-ms-expand displaynone3
style-jtub841gnavcontainerarrow style-jtub841gnavcontainersvgcontainer3
select border-radius03
selectdata-previewerror style-jtub841gnavcontainerarrow3
selectdata-previewerror style-jtstuaf4arrow3
style-k91s5bt32item background-colorrgba2553
style-k91s5bt32menucontainerarrow style-k91s5bt32menucontainersvgcontainer3
selectdata-previewerror style-k91s5bt32menucontainerarrow3
svg data-color13
data-color1 fill3
fill rgba533
border-radius0 -webkit-appearancenone-moz-appearancenone3
700 14px14em3
importantcolor2f2e2eborder-stylesolidborder-colorrgba47 463
border 05s3
46 055padding3pxmargin0max-width100-webkit-box-flex1-webkit-flex1flex1text-overflowellipsis3
p transitionopacity3
transitionopacity 05s3
rgba53 1363
mercadocarpageuriseoteleatendimentohidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypetitlechildrenteleatendimento mercadocartypemetapropsnamedescriptioncontentteleatendimento3
carrometakeywordsseopagetitleseoteleatendimento mercadocarpageuriseoteleatendimentohidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypetitlechildrenteleatendimento3
do carrometakeywordsseopagetitleseoteleatendimento3
0s border3
0s color3
wix-image positionabsolutetop0right0bottom0left03
color 05s3
0s opacity0border-radius03
opacity0border-radius0 displayinline-blockpositionabsoluteright0bottom100width140pxpadding10pxfont-size13pxline-height16pxbackgroundfffbox-shadow03
displayinline-blockpositionabsoluteright0bottom100width140pxpadding10pxfont-size13pxline-height16pxbackgroundfffbox-shadow0 1px3
0 063
pafter contentpositionabsolutebottom-12pxright10pxcolorffftext-shadow03
contentpositionabsolutebottom-12pxright10pxcolorffftext-shadow0 1px3
0 06border-radius03
style-jtstuaf4arrow style-jtstuaf4svgcontainer3
086
normal76
0567
166
calc10066
margin-left66
261
358
980px58
e52
451
background-color40
s40
540
color39
ease32
0s31
santo30
positionabsolutetop0right0bottom0left028
8h28
das28
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif27
border-width1px25
background-colorrgba25523
fontnormal21
04s20
border-radius020
1px19
style-k91s5bt32item19
funda18
txtnew18
15px14em18
acessrios17
peas17
616
barra16
tucuruvi16
24h16
em16
716
caminhes15
shopping15
guarulhos15
endereos15
style-k91s5bt32submenu15
andr15
rgba4715
style-k91s5bt32menucontainer15
amaro15
displaynone14
feriados14
consulte14
color605e5e14
important14
autopeas14
style-jtub841gnavcontainer13
style-jtstuaf413
background-colorrgba20413
9h12
da12
sexta12
overflowhidden12
05512
solid12
style-k91s5bt32menucontainerarrow11
ul11
05s11
font11
style-jtub841gnavcontainerarrow11
1background-colorrgba25511
style-jtstuaf4arrow11
no10
na10
color2f2e2e10
svg10
lojas10
selectdata-errortrue9
selectdata-previewerror9
o9
selectdata-previewfocus9
selectfocus9
selectdata-previewhover9
89
leo9
selecthover9
mercadocar9
0px9
border-stylesolidborder-colorrgba2498
98
referncia8
062border-stylesolidborder-colorrgba478
automotivas8
01border-stylesolidborder-colorrgba2558
desde8
atualmente8
oleo8
grande8
calotas8
sp8
rodas8
oferecendo8
qualidade8
automotivo8
motor8
atendimento8
variedade8
border-width2px8
carro8
lubrificantes8
pneu8
auto8
ffffff8
pneus8
ampla8
margin08
108
nossas7
content7
text-alignleft7
text-aligncenter7
ol7
margin0line-heightnormalletter-spacingnormal7
var7
positionstaticbox-shadow0007
horriosmetakeywordsseopagetitleseopageuriseolojashidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypemetapropsnamedescriptioncontentaricanduva7
rgba07
sem7
oramento7
2206-50007
style-jtub841gnavcontainerarrowstyle-jtub841gnavcontainercenter-direction6
style-jtub841gnavcontainerarrowstyle-jtub841gnavcontainerleft-direction6
style-k9da67lvinput6
style-jtub841gnavcontainerarrowstyle-jtub841gnavcontainerright-direction6
style-jtstuaf4arrowstyle-jtstuaf4right-direction6
style-k91s5bt32menucontainerarrowstyle-k91s5bt32menucontainercenter-direction6
border-width2pxborder-colorrgba2046
style-jtstuaf4arrowstyle-jtstuaf4center-direction6
style-jtzuc74iinput6
style-k91s5bt32menucontainerarrowstyle-k91s5bt32menucontainerright-direction6
select6
style-k91s5bt32menucontainerarrowstyle-k91s5bt32menucontainerleft-direction6
style-jtstuaf4arrowstyle-jtstuaf4left-direction6
pelo6
compre6
243px6
ou6
seu6
pea6
116
telefone6
style-jqgbrc6yinput6
retire6
uma6
unidades6
1bordersolid6
do6
3px6
style-jqgbzj91textarea6
sair6
style-jsqagn2gimageitemlink6
para6
imagebutton1activeimage5
imagebutton1hoverimage5
georgiapalatinobook5
16hsegunda5
antiquapalatino5
linotypeserif5
imagebutton1defaultimage5
border-left05
ultxtnew5
colorrgba965
125
135
if5
style-jsqagn2gimageitemzoom5
color605e5eword-breakbreak-worddisplayinline-blockline-height15
mais5
os4
22hsbado4
20hdomingos4
pecas4
20hndomingos4
peca4
positionabsolutetop0left0color373737width100height1004
neue4
22hnsbado4
helveticaneuew02-55roma4
helveticaneuew01-55roma4
maximum-scale104
paulocustomtruetypemetapropsnamestatecontentso4
helveticaneuew10-55roma4
televendascustomtruetypemetapropsnamecopyrightcontentmercadocarcustomtruetypemetapropsnameauthorcontentmercadocarcustomtruetypemetapropsnamecitycontentso4
helvetica4
arial4
initial-scale104
aditivos4
pneupeas4
aditivoscustomtruetypemetapropsnameabstractcontentecommerce4
bateria4
user-scalable0nameviewportcustomtruetypemetapropscontenttexthtmlhttp-equivcontent-typecustomtruetypemetapropsnameclassificationcontentauto4
n4
style-k91s5bt32label4
background-colorrgba1604
background-colorrgba474
colorffffff4
style-jsz426t4labelwrapper4
style-jsz426t4link4
style-jsz426t4label4
1box-sizingborder-box4
text-alignrightdirectionrtl4
transitioncolor4
1colordbdbdbborder-width1px4
border-stylesolidborder-colorrgba2194
display-webkit-boxdisplay-webkit-flexdisplayflex-webkit-box-orientvertical-webkit-box-directionnormal-webkit-flex-directioncolumnflex-directioncolumn4
lb1itemscontainer4
144
style-jt03rca8labelwrapper4
0positionrelativewhite-spacenowrap4
style-jsqfr2ndlabel4
style-jt03rca8label4
opacity04
16px14em4
14px14em4
154
b0b0b04
1border-radius04
p4
opacity14
positionabsolutetop0right0bottom0left0transitionborder-color4
width1004
style-jsqfr2ndlabelwrapper4
text-aligninitialdisplayflexalign-itemscenter4
justify-contentcenter4
justify-contentflex-start4
justify-contentflex-end4
style-jsqfr2ndlink4
style-jt03rca8link4
1border-stylesolidborder-colorrgba474
border-stylesolidborder-colorrgba474
transparent4
style-jtub841grepeaterbuttonlabel4
style-k91s5bt32itemhoverarealast-child4
style-jt68laimlabelwrapper4
style-jt68laimlink4
style-jt68laimlabel4
border-right04
right04
imagebutton1data-statepressed3
brasiltypemetapropsnamegoogle-site-verificationcontentkcnqh6rqzzoezixe8hnwrkbsoiid0ht8bg6a6qaqlqcustomtruetypemetapropsnamegooglecontentnotranslatecustomtruetypemetapropscharsetutf-8customtruetypemetapropsnamehandheldfriendlycontenttruecustomtruetypemetapropscontentwidthdevice-width3
produtosmetakeywordsseopagetitleseopageuriseoiniciohidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidn1gg6desktopbgmetadatapageidn1gg6ispresetfalseschemaversion10ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypefixedispresettruemobilecustomtruereftypebackgroundmediaidn1gg6mobilebgmetadatapageidn1gg6ispresetfalseschemaversion10ishiddenfalsecolorcolor11aligntypetopfittingtypefillscrolltypescrollispresettruemediasizingviewporttranslationdatauriseotranslatedfalseignorebottombottomanchorstrueogimagereftypeimageiddataitem-ke39m4humetadatapageidn1gg6ispresetfalseschemaversion20ishiddenfalsetitleuri0816cc21a1064cd15f4160b3e12f6c3849774fmv2pngwidth400height400altcachemaxagehours1advancedseodatatagstypetitlechildrenmercadocar3
style-k91s5bt32menucontainercenter-direction3
style-jtstuaf4center-direction3
select-moz-focusring3
style-jtstuaf4right-direction3
style-jtstuaf4left-direction3
style-jtstuaf4svgcontainer3
mercadocartypemetapropsnamedescriptioncontentteleatendimento3
mercadocarpageuriseoteleatendimentohidepagetrueismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalsepassworddigestdialoglanguageispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtrueispresettruemobilecustomtrueispresettruemediasizingviewporttranslationdatauriseotranslatedfalseadvancedseodatatagstypetitlechildrenteleatendimento3
imagebutton1data-statehovered3
strc1inlinecontent3
strc1data-responsive3
style-k9d99b1rbg3
17px14em3
style-k91s5bt32menucontainersvgcontainer3
style-k91s5bt32menucontainerleft-direction3
positionfixed3
importantleftauto3
importantz-index503
topautobottom03
left10pxright10px3
border03
style-jtoo8dvmbg3
border0px3
style-k91s5bt32menucontainerright-direction3
text-alignright3
oldirrtl3
style-k91s5bt32itemhoverareafirst-child3
produtostypemetapropsnamekeywordscontentauto3
peascustomtruetypemetapropsnamedescriptioncontento3
carrometakeywordsseopagetitleseoteleatendimento3
0353
text-align-lastlefttext-align-lastcenter3
wix-image3
063
pafter3
contentpositionabsolutebottom-12pxright10pxcolorffftext-shadow03
06border-radius03
style-jtub841gnavcontainerleft-direction3
width12px3
style-jtub841gnavcontainersvgcontainer3
backgroundtransparent3
opacity0border-radius03
selectfocus-ms-value3
select-ms-expand3
0003
colortransparenttext-shadow03
selectnotdata-previewfocusinvalid3
-webkit-appearancenone-moz-appearancenone3
45pxcursorpointerpositionrelativemax-width100min-width100min-height10pxheight100text-overflowellipsiswhite-spacenowrapdisplayblock3
option3
displayinline-blockpositionabsoluteright0bottom100width140pxpadding10pxfont-size13pxline-height16pxbackgroundfffbox-shadow03
border3
text-overflowellipsiswhite-spacenowrapoverflowhiddencolor44474dbackground-colorffffff3
163
1pxcursorpointer3
data-color13
1border-colorrgba473
fill3
pointer-eventsnone3
box-shadownone3
background-colortransparentbordersolid3
rgba533
style-jtub841gnavcontainercenter-direction3
transitionopacity3
positionrelativemin-height25pxdisplay-webkit-boxdisplay-webkit-flexdisplayflex-webkit-box-orientvertical-webkit-box-directionnormal-webkit-flex-directioncolumnflex-directioncolumn3
-webkit-appearancenone-moz-appearancenoneborder-width1px3
text-align-lastrightdirectionrtl3
importantcolor2f2e2eborder-stylesolidborder-colorrgba473
055padding3pxmargin0max-width100-webkit-box-flex1-webkit-flex1flex1text-overflowellipsis3
-moz-appearancetextfieldwidth1003
style-jtub841gnavcontainerright-direction3
style-k91s5bt32submenubefore3
text-align-lastleft3

Who hosts Mercadocar.com.br?

Mercadocar.com.br Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Not Applicable

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
16.7387%
GoDaddy.com, LLC
8.5968%
Namecheap, Inc.
4.2653%
Confluence Networks Inc
2.7791%
Google Inc.
2.3954%
Merit Network Inc.
1.8799%
Fara Negar Pardaz Khuzestan
1.8361%
1&1 Internet AG
1.8274%
Amazon.com, Inc.
1.7814%
Cogent Communications
1.6096%

HTTP Header Analysis for Mercadocar.com.br

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Wed, 28 Oct 2020 11:16:49 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.mercadocar.com.br/
x-wix-request-id: 1603883809.491562626576867812107
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=42
X-Seen-By: 6ivkWfREES4Y8b2pOpzk7Owfbs 7qUVAqsIx00yI78k=,sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVhT9gRHUF6iCEZerWBFcnqX,2d58ifebGbosy5xc FRalpJ091mROVVE1SwtijMbOSsgqgynYLX9VZQupT0Eu1oliYxPC3Dr8UfY TU/1IaV9w==,2UNV7KOq4oGjA5 PKsX47BzxWFBtKoqbaB2M/rwsEsk=,m0j2EEknGIVUW/liY8BLLmYVHm1DtakfzSOTrFG0wKU=,LWZ6Tylfijl32cnmU7 qjO7ExdjwPXLihZrnZYGR/JpGp/J3MBzgzU8QHrQuh4zQ,znxyTGNb715cyF9N4jtLDB7lSjNq4oDjwRefk2urp63Okn1he574oENCV6E9DMkq
Cache-Control: no-cache
Expires: -1

Mercadocar.com.br Domain Nameserver Information

HostIP AddressCountry
e.sec.dns.br 200.192.232.14
f.sec.dns.br 200.189.40.14


Need to find out who hosts Mercadocar.com.br?


Domain Registration (WhoIs) information for Mercadocar.com.br

 % Copyright (c) Nic.br
% The use of the data below is only permitted as described in
% full by the terms of use at https://registro.br/termo/en.html ,
% being prohibited its distribution, commercialization or
% reproduction, in particular, to use it for advertising or
% any similar purpose.
% 2020-05-15T02:32:17-03:00

domain: mercadocar.com.br
owner: MERCADOCAR MERCANTIL DE PECAS LTDA.
owner-c: MMPLT35
admin-c: MMPLT35
tech-c: MMPLT20
billing-c: MMPLT20
nserver: e.sec.dns.br
nsstat: 20200512 AA
nslastaa: 20200512
nserver: f.sec.dns.br
nsstat: 20200512 AA
nslastaa: 20200512
dsrecord: 13486 RSASHA1 4BAD2E04A376B9BD936C2A09B939FAB4950DC989
dsstatus: 20200512 DSOK
dslastok: 20200512
created: 19971117 #69767
changed: 20200417
expires: 20201117
status: published

nic-hdl-br: MMPLT35
person: Mercadocar Mercantil de Peças Ltda
created: 20200417
changed: 20200417

nic-hdl-br: MMPLT20
person: Mercadocar Mercantil de Peças Ltda
created: 20151201
changed: 20160126

% Security and mail abuse issues should also be addressed to
% cert.br, http://www.cert.br/ , respectivelly to Login to show email
and Login to show email
whois.registro.br accepts only direct match queries. Types
% of queries are: domain (.br), registrant (tax ID), ticket,
% provider, contact handle (ID), CIDR block, IP and ASN.

Websites with Similar Names

Merca-china.com
merca-china.com -&nbspmerca china Resources and Information.
Merca-empresas.com
My Blog – My WordPress Blog
Merca-tech.com.mx
Diseño Web, Tiendas Virtuales y Marketing Digital México
Merca-tool.com
mercatool.com
Merca-tsukimachi.jp
ながさき市民生活便利館 メルカつきまち

Recently Updated Websites

Bratislava.info (2 seconds ago.)Movingtotaxfree.net (2 seconds ago.)Tvmusicfree.com (2 seconds ago.)Rmcfit.com (2 seconds ago.)2827yb.com (2 seconds ago.)Leosoftm.com (3 seconds ago.)Tyrendmicro.com (3 seconds ago.)Fabbishme.com (4 seconds ago.)Zremtechnology.org (4 seconds ago.)Lilalovesart.com (4 seconds ago.)Homecarewinnipeg.com (5 seconds ago.)Trumpisnumber1.org (5 seconds ago.)Techportal.in (5 seconds ago.)Niclevicz.com.br (6 seconds ago.)Globalpersuasion.com (7 seconds ago.)Uneken.nl (7 seconds ago.)Jmfa.com (9 seconds ago.)Tj-store.com (9 seconds ago.)Tvnet.xyz (9 seconds ago.)Titusville.com (9 seconds ago.)Davidkvcs.com (10 seconds ago.)Cdvagabundo.com.br (11 seconds ago.)Uk-hopecenter.com (11 seconds ago.)Louisedoucet.com (12 seconds ago.)Yibovip497.com (12 seconds ago.)Julieohara.net (14 seconds ago.)Xsj810.com (15 seconds ago.)Oildigitalassets.com (16 seconds ago.)Autosheq.xyz (16 seconds ago.)Afciviliancarreers.com (18 seconds ago.)

Recently Searched Keywords

accept all cookies (1 second ago.)बांग्लादेशी सेक्स (2 seconds ago.)andparmesan (4 seconds ago.)virginia beach, virginia (5 seconds ago.)期末考试作文 (6 seconds ago.)terae takaa.fi (8 seconds ago.)k ton cng (8 seconds ago.)iman718 (8 seconds ago.)amb un (9 seconds ago.)corvette corvette lyrics youtube (9 seconds ago.)emerald prepaid (9 seconds ago.)146 109 1 (10 seconds ago.)presenta (10 seconds ago.)rf3 (11 seconds ago.)kiwi education ltd jobs (12 seconds ago.)degan (12 seconds ago.)7c2gt63c56cl-q-q 2hec2da2c64jl-qecf6-q gt2c8h5e9l-q-q (13 seconds ago.)traumatic (13 seconds ago.)shadbase comics (14 seconds ago.)myclean (14 seconds ago.)raise anatomy reportimprove your chances of receiving a raise when you ask. (15 seconds ago.)svenska spel telefonen 2015, social media (17 seconds ago.)musclefan comics (19 seconds ago.)专利申请 (19 seconds ago.)dollproject comics (20 seconds ago.)prismgirls comics (21 seconds ago.)lamar residence (25 seconds ago.)lamar beach (26 seconds ago.)false rows 4 (26 seconds ago.)fakku (27 seconds ago.)