Metrostlouis.org  |  Metro Transit – Saint Louis | MetroBus, MetroLink and Call-A-Ride – Moving the Community Forward
Low trust score  | 
Metropolitan Saint Louis Transit Agency providing MetroBus, MetroLink and Call-A-Ride paratransit services.

Metrostlouis.org Website Information

Metrostlouis.org has a Low Trust Score, a Statvoo Rank of G, an Alexa Rank of 457,221, a Majestic Rank of 206,226, a Domain Authority of 61% and is not listed in DMOZ.

Metrostlouis.org is hosted by XO Communications in United States.
Metrostlouis.org has an IP Address of 64.220.221.46 and a hostname of metrostlouis.org.

The domain metrostlouis.org was registered 1 decade 7 years 7 months ago by , it was last modified 201 decades 8 years 9 months ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for metrostlouis.org

Full Whois Lookup for Metrostlouis.org Whois Lookup

Domain Name: METROSTLOUIS.ORG
Registry Domain ID: D72557219-LROR
Registrar WHOIS Server:
Registrar URL: www.domain.com
Updated Date: 2017-06-05T19:35:08Z
Creation Date: 2001-06-12T20:58:30Z
Registry Expiry Date: 2018-06-12T20:58:30Z
Registrar Registration Expiration Date:
Registrar: Domain.com, LLC
Registrar IANA ID: 886
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registry Registrant ID: C170808432-LROR
Registrant Name: Internet Domain Administrator
Registrant Organization: Bi-State Development
Registrant Street: 211 North Broadway Suite 700
Registrant City: St. Louis
Registrant State/Province: MO
Registrant Postal Code: 63102
Registrant Country: US
Registrant Phone: +1.3149821400
Registrant Phone Ext:
Registrant Fax: +1.3149821558
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C170808433-LROR
Admin Name: Internet Domain Administrator
Admin Organization: Bi-State Development
Admin Street: 211 North Broadway Suite 700
Admin City: St. Louis
Admin State/Province: MO
Admin Postal Code: 63102
Admin Country: US
Admin Phone: +1.3149821400
Admin Phone Ext:
Admin Fax: +1.3149821558
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C170808435-LROR
Tech Name: Internet Domain Administrator
Tech Organization: Bi-State Development
Tech Street: 211 North Broadway Suite 700
Tech City: St. Louis
Tech State/Province: MO
Tech Postal Code: 63102
Tech Country: US
Tech Phone: +1.3149821400
Tech Phone Ext:
Tech Fax: +1.3149821558
Tech Fax Ext:
Tech Email: Login to show email
Server: NS1.XO.COM
Name Server: NS2.XO.COM
Name Server: NS3.XO.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-09-08T15:05:31Z

Who hosts Metrostlouis.org?

Metrostlouis.org Web Server Information

Hosted IP Address:64.220.221.46
Hosted Hostname:metrostlouis.org
Service Provider:XO Communications
Hosted Country:United StatesUS
Location Latitude:38
Location Longitude:-97
Webserver Software:Not Applicable

HTTP Header Analysis for Metrostlouis.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/7.0
X-AspNet-Version: 2.0.50727
X-Powered-By: ASP.NET
Date: Tue, 02 Jun 2015 10:15:38 GMT
Content-Length: 148818


Need to find out who hosts Metrostlouis.org?

Metrostlouis.org Free SEO Report

Website Inpage Analysis for Metrostlouis.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Metrostlouis.org

rider alerts300 functiondivsubmenusholderanimate heightplanner tripfunction issubmenusanimating falsepublic safety1epreventdefaultpassesfarestransitcontractsubmenusresetfares ampyousearchissubmenusanimatingtriptop4learnfunction issubmenusanimatingnavfunctioneparksthidesubmenusdesktopelsehttpwwwmetrostlouisorgwpcontentthemesmetroimagesarrowdownsvgpublicmapsmetrocontracttoolsschedules rider alertsblogamplearn moresearchvaluetruethisarrowattrsrcistoolsanimating0qtylinkscachedwidthservicesnewheightoneulmobile038arrowtopfares amp passesistoolsanimating falsehideanyheader navnewwidthschedulesheightnav ullouisamp passesfalse functionlearn more metrosystemwindowwidthdivsubmenusholderanimatemetro transitsafetysubmenu3thisarrowst louisdivbannerbuttons300 function issubmenusanimatingschedules riderplanner trip plannermore metroseptemberissubmenusanimating falseheaderfalsethisvalridetrip planner triptrip plannersubmenusdivsubmenusmenudivsubmenusholderheightinformationalertsusscheduleallgetvarifwindowincludingtrue varheader nav ulepreventdefault functionmorewindowresizeplannerrider2metrolinkfunctionfunctione var

Longtail Keyword Density for Metrostlouis.org

KeywordsOccurences
300 function issubmenusanimating4
function issubmenusanimating false4
header nav ul3
learn more metro3
schedules rider alerts3
trip planner trip3
planner trip planner3
fares amp passes3
learn more7
300 function6
trip planner6
metro transit5
issubmenusanimating false5
function issubmenusanimating4
divsubmenus-holderanimate height4
false function4
public safety4
amp passes3
planner trip3
fares amp3
st louis3
functione var3
schedules rider3
nav ul3
istoolsanimating false3
rider alerts3
true var3
epreventdefault function3
header nav3
more metro3
var37
function21
metro19
if18
transit11
false10
more9
learn8
height8
planner7
functione7
issubmenusanimating7
thisarrow6
safety6
hide6
else6
trip6
06
passes6
0386
contracttools5
nav5
true5
all5
15
divsubmenus5
amp5
schedules5
rider5
fares5
ride5
submenus5
thisarrowattrsrc5
divbanner-buttons4
reset4
24
windowwidth4
contractsubmenus4
menu4
httpwwwmetrostlouisorgwp-contentthemesmetroimagesarrow-downsvg4
newheight4
searchvalue4
divsubmenus-holderanimate4
hidesubmenusdesktop4
istoolsanimating4
you4
blog4
information4
34
system4
louis4
search4
september4
alerts4
44
public4
qtylinks3
submenu3
epreventdefault3
maps3
window3
newwidth3
arrowtop3
st3
cachedwidth3
services3
top3
windowresize3
thisval3
us3
ul3
any3
divsubmenus-holderheight3
including3
get3
mobile3
park3
header3
schedule3
one3
metrolink3

What are the nameservers for metrostlouis.org?

Metrostlouis.org Domain Nameserver Information

HostIP AddressCountry
ns1.xo.com 156.154.64.25United States United States
ns2.xo.com 156.154.65.25United States United States
ns3.xo.com 156.154.66.25United States United States

Metrostlouis.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Metrostlouis.org is a scam?