Museum of Fine Arts, Boston

Safety: High trust score
Year Founded: 1995
Global Traffic Rank: 12,124
Estimated Worth: $1,313,280
Last updated:2020-12-17

The MFA is one of the most comprehensive art museums in the world; the collection encompasses nearly 450,000 works of art. We welcome more than one million visitors each year to experience art from ancient Egyptian to contemporary, special exhibitions, and innovative educational programs.


Domain summary

Domain label
mfa
Domain extension
org
Domain registered:
1995-08-29
Domain updated:
2020-12-17
Global Traffic Rank
12,124
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$1,313,280
Estimated daily income
$1,824
Estimated monthly income
$55,480

Rank summary

How is mfa.org ranked relative to other sites:

Percentage of visits to mfa.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Mfa.org registered?
A: Mfa.org was registered 25 years, 4 months, 2 weeks, 6 days, 9 hours, 52 minutes, 6 seconds ago on Tuesday, August 29, 1995.
Q: When was the WHOIS for Mfa.org last updated?
A: The WHOIS entry was last updated 1 month, 1 day, 9 hours, 52 minutes, 6 seconds ago on Thursday, December 17, 2020.
Q: What are Mfa.org's nameservers?
A: DNS for Mfa.org is provided by the following nameservers:
  • dns2.zoneedit.com
  • dns1.zoneedit.com
  • dns3.zoneedit.com
Q: Who is the registrar for the Mfa.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Mfa.org?
A: Mfa.org ranks 12,124 globally on Alexa. Mfa.org has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Mfa.org each day?
A: Mfa.org receives approximately 151,999 visitors and 911,994 page impressions per day.
Q: What IP address does Mfa.org resolve to?
A: Mfa.org resolves to the IPv4 address 107.21.104.61.
Q: In what country are Mfa.org servers located in?
A: Mfa.org has servers located in the United States.
Q: What webserver software does Mfa.org use?
A: Mfa.org is powered by Nginx webserver.
Q: Who hosts Mfa.org?
A: Mfa.org is hosted by Amazon.com, Inc. in Virginia, Ashburn, United States, 20149.
Q: How much is Mfa.org worth?
A: Mfa.org has an estimated worth of $1,313,280. An average daily income of approximately $1,824, which is roughly $55,480 per month.

Mfa.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Mfa.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Mfa.org

H1 Headings

2 :
  1. Menus
  2. Home page

H2 Headings

9 :
  1. User Account Menu Mobile
  2. Main navigation
  3. Utility navigation
  4. Utility navigation
  5. Main navigation
  6. Visit Us
  7. Connect with Us
  8. Sign up for MFA Mail
  9. Footer

H3 Headings

6 :
  1. Art for This Moment
  2. Explore MFA Videos
  3. Online Events
  4. Digital Learning
  5. MFA at Google Arts & Culture
  6. MFA on YouTube

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

9 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

231:
  1. Mfa See updates on closure and tickets.
    http://mfa.org/visit/museum-closure-updates
  2. Mfa Log In
    https://tnew.mfa.org/account/login?returnurl=
  3. Mfa UserId Member
    https://tnew.mfa.org/account/update?returnurl=
  4. Mfa Edit Account
    https://tnew.mfa.org/account/update?returnurl=
  5. Mfa Manage Interests
    https://tnew.mfa.org/account/interests?returnurl=
  6. Mfa Manage Memberships
    https://tnew.mfa.org/account/memberships?returnurl=
  7. Mfa Log Out
    https://tnew.mfa.org/account/logout
  8. Mfa View Cart
    https://tnew.mfa.org/cart/details
  9. Mfa Museum of Fine Arts, Boston
    http://mfa.org/
  10. Mfa Visit
    http://mfa.org/visit
  11. Mfa Hours and Admission
    http://mfa.org/visit
  12. Mfa Getting Here
    http://mfa.org/visit/getting-here
  13. Mfa Parking
    http://mfa.org/visit/getting-here/parking
  14. Mfa Plan Your Visit
    http://mfa.org/visit/plan-your-visit
  15. Mfa Today at the MFA
    http://mfa.org/today
  16. Mfa Tips for Visitors
    http://mfa.org/visit/plan-your-visit/tips-visitors
  17. Mfa Map
    http://mfa.org/visit/plan-your-visit/map
  18. Mfa Gallery Updates
    http://mfa.org/visit/plan-your-visit/gallery-updates
  19. Mfa Event Spaces
    http://mfa.org/visit/plan-your-visit/event-spaces
  20. Mfa Visiting with Kids and Family
    http://mfa.org/visit/plan-your-visit/kids-and-family
  21. Mfa Visiting from Out of Town
    http://mfa.org/visit/plan-your-visit/visiting-out-town
  22. Mfa Hotel Packages
    http://mfa.org/visit/plan-your-visit/visiting-out-town/hotel-packages
  23. Mfa Dining
    http://mfa.org/visit/dining
  24. Mfa Shops
    http://mfa.org/visit/shops
  25. Mfa Groups
    http://mfa.org/visit/groups
  26. Mfa Adult and University
    http://mfa.org/visit/groups/adult-university
  27. Mfa School Group Visits
    http://mfa.org/visit/groups/school
  28. Mfa Tips for Groups
    http://mfa.org/visit/groups/visiting-tips
  29. Mfa Accessibility
    http://mfa.org/visit/accessibility
  30. Mfa Accessible Films
    http://mfa.org/visit/accessibility/programs/film
  31. Mfa Catering and Special Events
    http://mfa.org/visit/catering-and-special-events
  32. Mfa MFA Mobile
    http://mfa.org/visit/mfa-mobile
  33. Mfa Exhibitions
    http://mfa.org/exhibitions
  34. Mfa Current Exhibitions
    http://mfa.org/exhibitions
  35. Mfa Upcoming Exhibitions
    http://mfa.org/exhibitions/upcoming
  36. Mfa Past Exhibitions
    http://mfa.org/exhibitions/past
  37. Mfa Traveling Exhibitions
    http://mfa.org/exhibitions/traveling
  38. Mfa Available Traveling Exhibitions
    http://mfa.org/exhibitions/traveling/available-traveling-exhibitions
  39. Mfa Current and Upcoming Traveling Exhibitions
    http://mfa.org/exhibitions/traveling/current-and-upcoming
  40. Mfa Nagoya
    http://mfa.org/exhibitions/traveling/nagoya
  41. Mfa Programs
    http://mfa.org/programs
  42. Mfa Gallery Activities and Tours
    http://mfa.org/programs/gallery-activities-and-tours
  43. Mfa Talks in the Galleries
    http://mfa.org/programs/gallery-activities-and-tours/gallery-talks
  44. Mfa Curated Conversations
    http://mfa.org/programs/gallery-activities-and-tours/gallery-talks/curated-conversations
  45. Mfa Spotlight Talks
    http://mfa.org/programs/gallery-activities-and-tours/gallery-talks/spotlight-talks
  46. Mfa Guided Tours
    http://mfa.org/programs/gallery-activities-and-tours/guided-tours
  47. Mfa Artist Demonstrations
    http://mfa.org/programs/gallery-activities-and-tours/artist-demonstrations
  48. Mfa Artist Toolbox Cart
    http://mfa.org/programs/gallery-activities-and-tours/artist-toolbox-cart
  49. Mfa Drawing in the Galleries
    http://mfa.org/programs/gallery-activities-and-tours/drawing-in-the-galleries
  50. Mfa Lectures and Courses
    http://mfa.org/programs/lectures-and-courses
  51. Mfa Lectures
    http://mfa.org/programs/lectures-and-courses/lectures
  52. Mfa Courses
    http://mfa.org/programs/lectures-and-courses/courses
  53. Mfa Looking Together
    http://mfa.org/programs/lectures-and-courses/looking-together
  54. Mfa Studio Art Classes
    http://mfa.org/programs/studio-art-classes
  55. Mfa Adult Schedule
    http://mfa.org/programs/studio-art-classes/adult
  56. Mfa Teen Schedule
    http://mfa.org/programs/studio-art-classes/teen
  57. Mfa Kids Schedule
    http://mfa.org/programs/studio-art-classes/kids
  58. Mfa Tutorials at Home
    http://mfa.org/programs/studio-art-classes/videos
  59. Mfa Information and Policies
    http://mfa.org/programs/studio-art-classes/information-and-policies
  60. Mfa Studio Partnerships
    http://mfa.org/programs/studio-art-classes/partner-schools
  61. Mfa Film
    http://mfa.org/programs/film
  62. Mfa Music
    http://mfa.org/programs/music
  63. Mfa Performance Art
    http://mfa.org/programs/performance-art
  64. Mfa Special Events
    http://mfa.org/programs/special-event
  65. Mfa Kids and Family Programs
    http://mfa.org/programs/kids-and-family-programs
  66. Mfa MFA Playdates
    http://mfa.org/programs/kids-and-family-programs/mfa-playdates
  67. Mfa MFA Playdates at Home
    http://mfa.org/programs/kids-and-family-programs/mfa-playdates/mfa-playdates-at-home
  68. Mfa Junior Artists
    http://mfa.org/programs/kids-and-family-programs/junior-artists
  69. Mfa Junior Artists at Home
    http://mfa.org/programs/kids-and-family-programs/junior-artists/junior-artists-at-home
  70. Mfa Family Art Cart
    http://mfa.org/programs/kids-and-family-programs/family-art-cart
  71. Mfa Art Connections
    http://mfa.org/programs/kids-and-family-programs/art-connections
  72. Mfa Birthday Parties
    http://mfa.org/programs/kids-and-family-programs/birthday-parties
  73. Mfa School Vacation Weeks
    http://mfa.org/programs/kids-and-family-programs/school-vacation-weeks
  74. Mfa Teen Programs
    http://mfa.org/programs/teen-programs
  75. Mfa Teen Arts Council
    http://mfa.org/programs/teen-programs/teen-arts-council
  76. Mfa STEAM Team
    http://mfa.org/programs/teen-programs/steam-team
  77. Mfa Curatorial Study Hall
    http://mfa.org/programs/teen-programs/curatorial-study-hall
  78. Mfa Curatorial Study Hall Pilot Program and Materials
    http://mfa.org/programs/teen-programs/curatorial-study-hall/pilot-program-and-materials
  79. Mfa School Programs
    http://mfa.org/programs/school-programs
  80. Mfa Distance Learning
    http://mfa.org/programs/school-programs/distance-learning
  81. Mfa Educator Professional Development
    http://mfa.org/programs/school-programs/educator-professional-development
  82. Mfa Bus Grants and Admission Waivers
    http://mfa.org/programs/school-programs/bus-grants-and-admission-waivers
  83. Mfa College Programs
    http://mfa.org/programs/college-programs
  84. Mfa College Students
    http://mfa.org/programs/college-programs/students
  85. Mfa Events for College Students
    http://mfa.org/programs/college-programs/students/events
  86. Mfa College Faculty and Staff
    http://mfa.org/programs/college-programs/faculty-and-staff
  87. Mfa Events for College Faculty and Staff
    http://mfa.org/programs/college-programs/faculty-and-staff/events
  88. Mfa Community Programs
    http://mfa.org/programs/community-programs
  89. Mfa Artful Adventures
    http://mfa.org/programs/community-programs/artful-adventures
  90. Mfa Cub Scouts
    http://mfa.org/programs/community-programs/cub-scouts
  91. Mfa Girl Scouts
    http://mfa.org/programs/community-programs/girl-scouts
  92. Mfa Home School Programs
    http://mfa.org/programs/community-programs/home-school-programs
  93. Mfa Information and Policies
    http://mfa.org/programs/community-programs/home-school-programs/information-and-policies
  94. Mfa Supply Lists
    http://mfa.org/programs/community-programs/home-school-programs/supply-list
  95. Mfa MFA Artful Healing
    http://mfa.org/programs/community-programs/artful-healing
  96. Mfa Beyond the Spectrum
    http://mfa.org/programs/community-programs/beyond-the-spectrum
  97. Mfa Community Arts Initiative
    http://mfa.org/programs/community-programs/community-arts-initiative
  98. Mfa Art and Medicine Workshops
    http://mfa.org/programs/community-programs/art-and-medicine-workshops
  99. Mfa Off-site Programs
    http://mfa.org/programs/community-programs/off-site-programs
  100. Mfa Community Partners
    http://mfa.org/programs/community-programs/partners
  101. Mfa Request Community Visit
    http://mfa.org/programs/community-programs/request-community-visit
  102. Mfa Resources
    http://mfa.org/programs/community-programs/resources
  103. Mfa Collections
    http://mfa.org/collections
  104. Mfa Collections Search
    https://collections.mfa.org
  105. Mfa Africa and Oceania
    http://mfa.org/collections/africa-and-oceania
  106. Mfa Art of the Benin Kingdom
    http://mfa.org/collections/art-of-the-benin-kingdom
  107. Mfa Americas
    http://mfa.org/collections/art-americas
  108. Mfa Cyrus Dallin’s ‘Appeal to the Great Spirit’
    http://mfa.org/collections/art-americas/appeal-to-the-great-spirit
  109. Mfa Henry Luce Foundation Exhibitions
    http://mfa.org/collections/art-americas/collecting-stories
  110. Mfa The John Singer Sargent Archive
    http://mfa.org/collections/americas/the-john-singer-sargent-archive
  111. Mfa Finding Aid
    http://mfa.org/collections/americas/the-john-singer-sargent-archive/finding-aid
  112. Mfa Art Bridges + Terra Foundation Initiative
    http://mfa.org/collections/art-americas/art-bridges-terra-foundation-initiative
  113. Mfa Ancient Egypt, Nubia, Near East
    http://mfa.org/collection/ancient-egypt-nubia-and-the-near-east
  114. Mfa Nubian Art
    http://mfa.org/collections/nubian-art
  115. Mfa Ancient Greece and Rome
    http://mfa.org/collection/ancient-greece-and-rome
  116. Mfa Asia
    http://mfa.org/collections/asia
  117. Mfa Art of the Japanese Postcard
    http://mfa.org/collections/asia/art-japanese-postcard
  118. Mfa Contemporary Art
    http://mfa.org/collections/contemporary-art
  119. Mfa Performance Art
    http://mfa.org/collections/contemporary-art/performance-art
  120. Mfa Europe
    http://mfa.org/collections/europe
  121. Mfa Center for Netherlandish Art
    http://mfa.org/collections/center-for-netherlandish-art
  122. Mfa Jewelry
    http://mfa.org/collections/jewelry
  123. Mfa Judaica
    http://mfa.org/collections/judaica
  124. Mfa Photography
    http://mfa.org/collections/photography
  125. Mfa The Howard Greenberg Collection
    http://mfa.org/collections/photography/howard-greenberg-collection
  126. Mfa Prints and Drawings
    http://mfa.org/collections/prints-and-drawings
  127. Mfa Postcards at the MFA
    http://mfa.org/collections/prints-and-drawings/postcards-at-the-mfa
  128. Mfa Musical Instruments
    http://mfa.org/collections/musical-instruments
  129. Mfa Technical Drawings
    http://mfa.org/collections/musical-instruments/technical-drawings
  130. Mfa Textile and Fashion Arts
    http://mfa.org/collections/textile-and-fashion-arts
  131. Mfa Conservation and Collections Management
    http://mfa.org/collections/conservation-and-collections-management
  132. Mfa Asian Conservation Studio
    http://mfa.org/collections/conservation/division_asianstudio
  133. Mfa Furniture and Frame Conservation Laboratory
    http://mfa.org/collections/conservation/division_furnitureframelab
  134. Mfa Objects Conservation Lab
    http://mfa.org/collections/conservation/division_objectslab
  135. Mfa Paintings Conservation Studio
    http://mfa.org/collections/conservation/division/paintings-studio
  136. Mfa Paper Conservation Lab
    http://mfa.org/collections/conservation/division/paper-lab
  137. Mfa Textile Conservation Lab
    http://mfa.org/collections/conservation/division_textilelab
  138. Mfa Scientific Research Laboratory
    http://mfa.org/collections/conservation/division_scientificresearchlab
  139. Mfa Collections Management
    http://mfa.org/collections/conservation/division_collectionsmanagement
  140. Mfa Libraries and Archives
    http://mfa.org/collections/libraries-and-archives
  141. Mfa Library Exhibition
    http://mfa.org/collections/libraries-and-archives/library-exhibition
  142. Mfa MFA Images
    http://mfa.org/collections/mfa-images
  143. Mfa Licensing
    http://mfa.org/collections/mfa-images/licensing/frequently-asked-questions
  144. Mfa Reproduction Request Form
    http://mfa.org/collections/mfa-images/licensing/reproduction-request-form
  145. Mfa Archival Replicas
    http://mfa.org/collections/mfa-images/archival-replicas
  146. Mfa Archival Replicas Order Form
    http://mfa.org/collections/mfa-images/archival-replicas/order-form
  147. Mfa Study and Personal Use
    http://mfa.org/collections/mfa-images/study-and-personal-use
  148. Mfa Request Images for Study and Personal Use
    http://mfa.org/collections/mfa-images/study-and-personal-use/request-images-for-study-and-personal-use
  149. Mfa Location Filming
    http://mfa.org/collections/mfa-images/location-filming
  150. Mfa Merchandise Licensing
    http://mfa.org/collections/mfa-images/merchandise-licensing
  151. Mfa Popular Categories
    http://mfa.org/collections/mfa-images/popular-categories
  152. Mfa Web Use and Gallery Photography
    http://mfa.org/collections/mfa-images/web-use-and-gallery-photography
  153. Mfa State-of-the-Art Photography
    http://mfa.org/collections/mfa-images/state-art-photography
  154. Mfa Terms and Conditions
    http://mfa.org/collections/mfa-images/terms-and-conditions
  155. Mfa Provenance
    http://mfa.org/collections/provenance
  156. Mfa Nazi-Era Provenance Research
    http://mfa.org/collections/provenance/nazi-era-provenance-research
  157. Mfa Ownership Resolutions
    http://mfa.org/collections/provenance/ownership-resolutions
  158. Mfa Acquisitions and Provenance Policy
    http://mfa.org/collections/provenance/acquisitions-and-provenance-policy
  159. Mfa Antiquities and Cultural Property
    http://mfa.org/collections/provenance/antiquities-and-cultural-property
  160. Mfa Italian Ministry of Culture Agreement
    http://mfa.org/collections/provenance/antiquities-and-cultural-property/italian-ministry-of-culture-agreement
  161. Mfa Nigerian Antiquities
    http://mfa.org/collections/provenance/antiquities-and-cultural-property/nigerian-antiquities
  162. Mfa Weary Herakles
    http://mfa.org/collections/provenance/antiquities-and-cultural-property/weary-herakles
  163. Mfa Colonialism
    http://mfa.org/collections/provenance/colonialism
  164. Mfa Publications
    http://mfa.org/collections/publications
  165. Mfa Membership
    http://mfa.org/membership
  166. Mfa Levels and Benefits
    http://mfa.org/membership
  167. Mfa Member Events
    http://mfa.org/membership/member-events
  168. Mfa Member Talks
    http://mfa.org/membership/member-events/member-talks
  169. Mfa Gift Membership
    http://mfa.org/membership/gift-membership
  170. Mfa Patron Program
    http://mfa.org/membership/patron-program
  171. Mfa Events
    http://mfa.org/membership/patron-program/events
  172. Mfa Newsletter
    http://mfa.org/membership/patron-program/news
  173. Mfa Travel
    http://mfa.org/membership/patron-program/travel
  174. Mfa Museum Council
    http://mfa.org/membership/museum-council
  175. Mfa Events
    http://mfa.org/membership/museum-council/events
  176. Mfa Newsletter
    http://mfa.org/membership/museum-council/news
  177. Mfa Meet-Ups
    http://mfa.org/membership/museum-council/meet-ups
  178. Mfa Curators Circles
    http://mfa.org/membership/curators-circles
  179. Mfa Frequently Asked Questions
    http://mfa.org/membership/frequently-asked-questions
  180. Mfa Organizational Memberships
    http://mfa.org/membership/organizational-memberships
  181. Mfa Corporations
    http://mfa.org/give/corporate-partnerships
  182. Mfa Universities
    http://mfa.org/membership/universities
  183. Mfa Libraries and Non-Profits
    http://mfa.org/membership/libraries-and-non-profits
  184. Mfa Give
    http://mfa.org/give
  185. Mfa Give to the MFA
    http://mfa.org/give
  186. Mfa Corporate Partnerships
    http://mfa.org/give/corporate-partnerships
  187. Mfa Corporate Sponsorship
    http://mfa.org/give/corporate-partnerships/corporate-sponsorship
  188. Mfa Corporate Membership
    http://mfa.org/give/corporate-partnerships/corporate-membership
  189. Mfa Current Corporate Members
    http://mfa.org/give/corporate-partnerships/corporate-membership/member-listing
  190. Mfa Events for Corporate Members
    http://mfa.org/give/corporate-partnerships/corporate-membership/events
  191. Mfa Curated Experiences
    http://mfa.org/give/corporate-partnerships/corporate-membership/curated-experiences
  192. Mfa Planned Giving
    http://mfa.org/give/planned-giving
  193. Mfa Sargent Society
    http://mfa.org/give/planned-giving/sargent-society
  194. Mfa Types of Gifts
    http://mfa.org/give/planned-giving/types-gifts
  195. Mfa Bequests
    http://mfa.org/give/planned-giving/types-gifts/bequests
  196. Mfa Charitable Gift Annuity
    http://mfa.org/give/planned-giving/types-gifts/charitable-gift-annuity
  197. Mfa Giving Retirement Plan Assets
    http://mfa.org/give/planned-giving/types-gifts/giving-retirement-plan-assets
  198. Mfa IRA Charitable Rollover
    http://mfa.org/give/planned-giving/types-gifts/ira-charitable-rollover
  199. Mfa Newsletter
    http://mfa.org/give/planned-giving/newsletter
  200. Mfa Gifts of Art
    http://mfa.org/give/gifts-art
  201. Mfa How to Give Art
    http://mfa.org/give/gifts-art/how-give-art
  202. Mfa Featured Gifts of Art
    http://mfa.org/give/gifts-art/featured-gifts-art
  203. Mfa The Denman Waldo Ross Society
    http://mfa.org/give/gifts-art/denman-waldo-ross-society
  204. Mfa Spring Study: Seminars for Collectors
    http://mfa.org/give/gifts-art/denman-waldo-ross-society/spring-study-seminars-for-collectors
  205. Mfa The Heritage Fund for a Diverse Collection
    http://mfa.org/give/gifts-art/heritage-fund
  206. Mfa MFA Fund
    http://mfa.org/give/mfa-fund
  207. Mfa Automatic Giving
    http://mfa.org/give/mfa-fund/automatic-giving
  208. Mfa Frequently Asked Questions
    http://mfa.org/give/frequently-asked-questions
  209. Mfa Matching Gifts
    http://mfa.org/give/matching-gifts
  210. Mfa Gifts of Securities
    http://mfa.org/give/gifts-of-securities
  211. Mfa Request Information
    http://mfa.org/give/request-information
  212. Mfa Tickets
    http://mfa.org/tickets
  213. Mfa Give Today
    http://mfa.org/give/mfa-fund
  214. Mfa Monet and Boston: Lasting Impression Through February 28, 2021
    http://mfa.org/exhibition/monet-and-boston-lasting-impression
  215. Mfa Writing the Future: Basquiat and the Hip-Hop Generation Through May 16, 2021
    http://mfa.org/exhibition/writing-the-future
  216. Mfa Cézanne: In and Out of Time Through February 28, 2021
    http://mfa.org/exhibition/cezanne-in-and-out-of-time
  217. Mfa Today's Hours Closed
    http://mfa.org/visit
  218. Mfa Become a Member
    http://mfa.org/membership
  219. Mfa Art for This Moment Personal responses to the collection
    http://mfa.org/article/2020/rouen-cathedral-series
  220. Mfa Explore MFA Videos Browse exhibition tours, artist interviews, and more
    http://mfa.org/videos
  221. Mfa Online Events Stream conversations, classes, music, and more
    http://mfa.org/programs/online-events
  222. Mfa Digital Learning For educators, families, and art enthusiasts
    http://mfa.org/programs/digital-learning
  223. Mfa Search the Collection
    https://collections.mfa.org
  224. Mfa Plan Your Visit
    http://mfa.org/visit
  225. Mfa Sign Up
    http://mfa.org//tnew.mfa.org/account/create/brief
  226. Mfa About
    http://mfa.org/about
  227. Mfa Working at the MFA
    http://mfa.org/employment
  228. Mfa Press
    http://mfa.org/news
  229. Mfa Contact
    http://mfa.org/about/contact-us
  230. Mfa Privacy Policy
    http://mfa.org/privacy
  231. Mfa Terms of Use
    http://mfa.org/about/terms-of-use

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Mfa.org

requesteastconservation and collectionsancient egyptreplicasfrequently asked questionsgettingpatronmembershiplabmfa fundfrequentlyviewslideaskeddrawingsgifts of artthroughinstrumentscollege facultymoregalleryasiamobileinformationlectures and coursesexhibitionsartcurrentlogcuratorial studymuseumstudy and personalmanagementplan yourphotographylibrariescommunity programsmembercollectiontimefine arts bostonteen programstravelingspecial eventsyour visitback collegeplanned givingstaffcartaccessibilitygomanageupdatesplannedprintsmembershipsnewsletterpersonal useartsprograms backfrequently askedmusiccollegeprovenanceegyptupcomingcollege programscuratoriallicensingnubiacorporate partnershipsperformanceschool programsstudiotextileexhibitions currentstudio artuselecturesgivingpatron programticketsactivities and tourshereperformance artadmissioncuratorial study hallnearasked questionsegypt nubia nearfineview cartjuniorfamilymainprogramtodaynear eastprogramsmember eventsmuseum of finemfastudio art classesquestionsschoolbacktalksancientfamily programskidssargentschedulemfa imagesconservation labplaydatesstudy hallartfulgallery activitiesmfa playdatesaccountstudentsnubia nearoceanianubia near eastsocietyinformation and policiesgiftpersonalpoliciesvisitarchiveshomeantiquitiesgiveartistmusical instrumentsart classescouncilfine artsnavigationplanamericascorporateartistsorganizational membershipscontemporaryfaculty and staffsearchclassestraveling exhibitionsjunior artiststourspartnershipsegypt nubiaback mfaafrica and oceaniateenoutgalleriesbostonimagesvisitinghallarchival replicasactivitiescollectionsmuseum councilarts bostonprints and drawingsgo to slidearchivalspecialgetting herekids and familystudyfacultygiftseventsgive todayeuropeplan your visitafricalibraries and archivesfundorganizationalancient egypt nubiacommunityyourcollege studentscontemporary arthourscoursescollections managementmusicalgroups0conservation

Longtail Keyword Density for Mfa.org

KeywordsOccurences
plan your visit4
kids and family4
gifts of art4
museum of fine3
egypt nubia near3
frequently asked questions3
study and personal3
libraries and archives3
conservation and collections3
prints and drawings3
nubia near east3
africa and oceania3
ancient egypt nubia3
fine arts boston3
faculty and staff3
curatorial study hall3
information and policies3
studio art classes3
lectures and courses3
activities and tours3
go to slide3
programs back7
traveling exhibitions5
special events5
school programs5
view cart4
back mfa4
plan your4
your visit4
collections management4
near east3
contemporary art3
musical instruments3
conservation lab3
mfa images3
archival replicas3
personal use3
museum council3
member events3
patron program3
egypt nubia3
frequently asked3
asked questions3
organizational memberships3
corporate partnerships3
planned giving3
mfa fund3
nubia near3
college students3
ancient egypt3
family programs3
arts boston3
getting here3
exhibitions current3
gallery activities3
studio art3
art classes3
performance art3
mfa playdates3
community programs3
junior artists3
teen programs3
curatorial study3
study hall3
college programs3
back college3
fine arts3
college faculty3
give today3
back60
art24
mfa23
programs23
exhibitions17
events14
gifts10
collections10
conservation9
give9
college9
visit9
arts9
corporate8
school8
museum7
study7
membership7
member7
community6
home6
studio6
cart6
lectures5
use5
giving5
traveling5
memberships5
out5
provenance5
special5
request5
family5
boston5
tours5
kids5
ancient5
gallery5
search5
photography5
teen5
plan5
information5
partnerships4
main4
program4
drawings4
management4
libraries4
images4
personal4
fund4
collection4
council4
groups4
courses4
accessibility4
classes4
your4
today4
current4
navigation4
log4
view4
talks4
manage4
fine3
antiquities3
time3
schedule3
mobile3
replicas3
archival3
archives3
hours3
lab3
licensing3
newsletter3
gift3
society3
slide3
go3
03
through3
updates3
tickets3
planned3
patron3
account3
organizational3
questions3
asked3
frequently3
getting3
admission3
prints3
textile3
staff3
policies3
artist3
music3
performance3
playdates3
junior3
artists3
galleries3
curatorial3
hall3
activities3
upcoming3
students3
faculty3
artful3
instruments3
africa3
oceania3
americas3
sargent3
visiting3
egypt3
nubia3
near3
east3
asia3
contemporary3
europe3
here3
musical3
more3

Who hosts Mfa.org?

Mfa.org Hosting Provider Information

Hosted IP Address:107.21.104.61
Hosted Hostname:ec2-107-21-104-61.compute-1.amazonaws.com
Service Provider:Amazon.com, Inc.
Hosted Country:United StatesUS
Location Latitude:39.0481
Location Longitude:-77.4729
Webserver Software:nginx

Is "Amazon.com, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for Mfa.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Thu, 17 Dec 2020 19:34:19 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: max-age=2764800, public
X-Drupal-Dynamic-Cache: UNCACHEABLE
Link:; rel="revision"
X-UA-Compatible: IE=edge
Content-language: en
X-Content-Type-Options: nosniff
X-Frame-Options: SAMEORIGIN
Expires: Sun, 19 Nov 1978 05:00:00 GMT
Last-Modified: Thu, 17 Dec 2020 19:34:19 GMT
ETag: "1608233659"
Vary: Cookie,Accept-Encoding
X-Generator: Drupal 8 (https://www.drupal.org)
X-Drupal-Cache: MISS
Content-Encoding: gzip
X-Request-ID: v-db3970cc-409e-11eb-8359-afa7e016d67e
X-AH-Environment: prod
Age: 0
Via: varnish
X-Cache: MISS
Accept-Ranges: bytes

Mfa.org Domain Nameserver Information

HostIP AddressCountry
dns2.zoneedit.com 45.79.110.158
dns1.zoneedit.com 45.77.82.193
dns3.zoneedit.com 45.76.95.243


Need to find out who hosts Mfa.org?


Domain Registration (WhoIs) information for Mfa.org

 Domain Name: MFA.ORG
Registry Domain ID: D5145600-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2020-11-02T18:16:54Z
Creation Date: 1995-08-29T04:00:00Z
Registry Expiry Date: 2030-08-28T04:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Museum of Fine Arts, Boston
Registrant State/Province: MA
Registrant Country: US
Name Server: DNS2.ZONEEDIT.COM
Name Server: DNS1.ZONEEDIT.COM
Name Server: DNS3.ZONEEDIT.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-12-17T19:33:19Z

Websites with Similar Names

Mfa-accessories.com
mfa-accessories.com is under construction
Mfa-andorra.com
Department of Migration and Foreign Affairs
Mfa-austria.com
MFA Vertriebsgesellschaft m.b.H
Mfa-bc.org
easyDNS Parked Page for: mfa-bc.org
Mfa-cn.com
可信的企业级“身份安全“整体方案
Mfa-eg.com
mfa-eg.com - Registered at Namecheap.com
Mfa-group.com
mfa-group.com is available for purchase - Sedo.com
Mfa-handbook.info
Home: Handbook of Material Flow Analysis: For Environmental, Resource, and Waste Engineers, Second Edition

Recently Updated Websites

Erenozkan.xyz (1 second ago.)Zjzkavc.work (34 seconds ago.)Nrdlqy.work (34 seconds ago.)Pdndxu.work (34 seconds ago.)Qkapet.work (35 seconds ago.)Kupacup.xyz (35 seconds ago.)Pqzjwes.work (38 seconds ago.)Qcpafl.work (43 seconds ago.)Lifechanginggizmos.xyz (47 seconds ago.)Prdagh.work (51 seconds ago.)Zmpydvi.work (51 seconds ago.)Kcweqe.work (58 seconds ago.)Qesgwr.work (58 seconds ago.)Qmnpmja.work (58 seconds ago.)Pdmgpz.work (1 minute ago.)Divazio.xyz (1 minute ago.)Znzvsra.work (1 minute 5 seconds ago.)Owmqsnm.work (1 minute 5 seconds ago.)Ovdjmc.work (1 minute 6 seconds ago.)Prfpuud.work (1 minute 7 seconds ago.)Qduzuei.work (1 minute 7 seconds ago.)Arca-aria.xyz (1 minute 7 seconds ago.)Chasxlogs14.xyz (1 minute 7 seconds ago.)Ybmqzin.work (1 minute 8 seconds ago.)Psnevx.work (1 minute 11 seconds ago.)Kkdblg.work (1 minute 15 seconds ago.)Click-now2start.xyz (1 minute 17 seconds ago.)Govtonline.xyz (1 minute 17 seconds ago.)Puwxoc.work (1 minute 20 seconds ago.)Kwdhvh.work (1 minute 23 seconds ago.)

Recently Searched Keywords

front page (1 second ago.)ddm2repeaterbuttonlabel (4 seconds ago.)mehr zum (6 seconds ago.)magie blanche (8 seconds ago.)wypożyczalnia sprzętu medycznego (9 seconds ago.)proposait (9 seconds ago.)rss okuyucu (13 seconds ago.)1076 (14 seconds ago.)70 71 (15 seconds ago.)piosenki (16 seconds ago.)chucky horror movie in hindi (16 seconds ago.)style-kg0heh5wnavcontainerarrowstyle-kg0heh5wnavcontainerleft-direction (17 seconds ago.)más... (18 seconds ago.)website design & development we design digital and physical experiences that transform brands, engage customers and grow businesses. (18 seconds ago.)fatih mehmet (18 seconds ago.)best available technology (21 seconds ago.)cessna8 (21 seconds ago.)tại sao khách hàng tin tưởng lựa chọn dịch vụ của du lịch khát vọng việt (21 seconds ago.)used to be easy (22 seconds ago.)iqoo u1x正式上架,搭载骁龙662,899元起 (24 seconds ago.)ftta education support (26 seconds ago.)tại sao khách hàng tin tưởng lựa chọn dịch vụ của du lịch khát vọng việt (29 seconds ago.)xuất tinh sớm có ảnh hưởng tới chất lượng của tinh trùng (32 seconds ago.)than 100 recipes (35 seconds ago.)omega replica (36 seconds ago.)papież jan paweł ii (37 seconds ago.)cargo pumps (38 seconds ago.)�պ���Ƶ (39 seconds ago.)boise school district (43 seconds ago.)date april (43 seconds ago.)