Home

Safety: Low trust score
Year Founded: 2016
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet

Home



Domain summary

Last updated
2021-03-27
Domain label
michellefiore
Domain extension
org
Domain registered:
2016-04-13
Domain updated:
2021-03-27
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is michellefiore.org ranked relative to other sites:

Percentage of visits to michellefiore.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Michellefiore.org registered?
A: Michellefiore.org was registered 5 years, 3 weeks, 5 days, 8 hours, 20 minutes, 53 seconds ago on Wednesday, April 13, 2016.
Q: When was the WHOIS for Michellefiore.org last updated?
A: The WHOIS entry was last updated 1 month, 1 week, 6 days, 8 hours, 20 minutes, 53 seconds ago on Saturday, March 27, 2021.
Q: What are Michellefiore.org's nameservers?
A: DNS for Michellefiore.org is provided by the following nameservers:
  • maya.ns.cloudflare.com
  • logan.ns.cloudflare.com
Q: Who is the registrar for the Michellefiore.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Michellefiore.org?
A: Michellefiore.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Michellefiore.org each day?
A: Michellefiore.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Michellefiore.org resolve to?
A: Michellefiore.org resolves to the IPv4 address 104.17.201.73.
Q: In what country are Michellefiore.org servers located in?
A: Michellefiore.org has servers located in the United States.
Q: What webserver software does Michellefiore.org use?
A: Michellefiore.org is powered by CloudFlare webserver.
Q: Who hosts Michellefiore.org?
A: Michellefiore.org is hosted by CloudFlare, Inc. in United States.
Q: How much is Michellefiore.org worth?
A: Michellefiore.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Michellefiore.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Michellefiore.org Free SEO Report

Website Inpage Analysis for Michellefiore.org

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

1 :
  1. Miss Fiore may be reached at [email protected]

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

3 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Michellefiore.org

000 0borderbottomsolidspanhoverborder2pxlinknavigationlinkhover000 0borderrightsolid 000navigationlinknavigationlinkactivepage spanborder2px solid0medianavigationlinknavigationlinkactivepage spanafterbackgroundcolorffffffmedia screennavchildren navigationlinkhoverborder2pxmobilecontentactivenavchildren navigationlinknavigationlinkactivepageborder2pxspanbeforebackgroundcolorffffffmedia screen0borderbottomsolid 000navchildren navigationlinknavigationlinkactivepageborder2px solidnavigationlinkhoverborder2pxspanborder2px solidsolid ffffffpipdatatowerid794311a7d32545539af74f15b00c3bcd010border60empipdatatowerid794311a7d32545539af74f15b00c3bcd010borderdesktoplinks navchildrennavchildrennavchildrennavchildrennavchildrennavchildren navigationlinkhoverborder2px solid30empipdatatowerid794311a7d32545539af74f15b00c3bcd010border10px 10px000 0borderrightsolidopacity 07richtexteditablecontainerlink navigationlink1spanafterbackgroundcolorffffffmediaspanborder2px0borderrightsolid 000 0borderbottomsolidnotnavchildren linkopacityminwidth10px 10pxjustifycontentflexstartmedia screenlink navigationlink spanhoverborder2pxnavigationlinkhoverborder2px solidnavigationlinknavigationlinkactivepageffffffmediaminwidth 60empipdatatowerid794311a7d32545539af74f15b00c3bcd010fill0 0media0borderbottomsolid 000 0borderleftsolid60empipdatatowerid794311a7d32545539af74f15b00c3bcd010sandwich07minwidth 30empipdatatowerid794311a7d32545539af74f15b00c3bcd010fillnavigationlinknavigationlinkactivepage spanborder2px0 0 0medianotnavchildren link navigationlinknavchildren10px 10px 10pxjustifycontentflexstartmedianavigationlinknavigationlinkactivepageborder2px solidlink navigationlinknavigationlinkactivepage spanborder2px0notnavchildrenminwidth 30empipdatatowerid794311a7d32545539af74f15b00c3bcd010sandwich0 0richtexteditablecontent30empipdatatowerid794311a7d32545539af74f15b00c3bcd010fill30empipdatatowerid794311a7d32545539af74f15b00c3bcd010sandwichsolid ffffffmedia0borderleftsolid 0000 0media screen000 0borderleftsolid 000solid ffffffmedia screen0borderleftsolidminwidth 30empipdatatowerid794311a7d32545539af74f15b00c3bcd010borderminwidth 60empipdatatowerid794311a7d32545539af74f15b00c3bcd010borderrichtexteditablecontent opacityminwidth 60empipdatatowerid794311a7d32545539af74f15b00c3bcd010sandwichdesktoplinksscreen000spanbeforebackgroundcolorffffffmedianavigationlinknavigationlinkactivepageborder2pxspanhoverborder2px solid10pxjustifycontentflexstartmedia screen000 0borderleftsolidcolor fd437410pxjustifycontentflexstartmedianavigationlink spanhoverborder2px solidcolor 36363610px 10pxjustifycontentflexstartmedianavigationlinkffffffmedia screen0borderrightsolid 000richtexteditablecontent opacity 07link navigationlinknavigationlinkactivepage000 0borderbottomsolid 000navchildrennavchildrennavchildrennavchildrennavchildrennotnavchildren link navigationlinknavigationlinkactivepageffffffpipdatatowerid794311a7d32545539af74f15b00c3bcd010borderminwidth 60emblockblock0media screennavigationlink spanhoverborder2pxscreen and minwidth60emblockblock60empipdatatowerid794311a7d32545539af74f15b00c3bcd010fillspanafterbackgroundcolorffffffmedia screen10pxpipdatatowerid794311a7d32545539af74f15b00c3bcd010color0borderrightsolid0borderbottomsolidnavigationlinknavigationlinkactivepage spanafterbackgroundcolorffffffmedianavigationlinkhover spanafterbackgroundcolorffffffmedia screenfd4374solidnavigationlinkhover spanafterbackgroundcolorffffffmedia

Longtail Keyword Density for Michellefiore.org

KeywordsOccurences
screen and min-width59
0 0 0media8
0 0media screen8
solid ffffffmedia screen8
notnav-children link navigation-link6
notnav-children link navigation-linknavigation-link-active-page6
navigation-linkhover spanafterbackground-colorffffffmedia screen4
navigation-linknavigation-link-active-page spanafterbackground-colorffffffmedia screen4
10px 10pxjustify-contentflex-startmedia screen4
10px 10px 10pxjustify-contentflex-startmedia4
000 0border-bottomsolid 0003
0border-bottomsolid 000 0border-leftsolid3
000 0border-leftsolid 0003
0border-rightsolid 000 0border-bottomsolid3
000 0border-rightsolid 0003
rich-text-editable-content opacity 073
link navigation-linknavigation-link-active-page spanborder2px3
navigation-linknavigation-link-active-page spanborder2px solid3
link navigation-link spanhoverborder2px3
navigation-link spanhoverborder2px solid3
nav-children navigation-linknavigation-link-active-pageborder2px solid3
nav-children navigation-linkhoverborder2px solid3
0 012
notnav-children link12
10px 10px10
ffffffmedia screen8
0 0media8
0media screen8
solid ffffffmedia8
spanafterbackground-colorffffffmedia screen8
link navigation-link6
link navigation-linknavigation-link-active-page6
min-width 60empipdata-tower-id794311a7d32545539af74f15b00c3bcd-0-1-0border4
min-width 60empipdata-tower-id794311a7d32545539af74f15b00c3bcd-0-1-0sandwich4
spanbeforebackground-colorffffffmedia screen4
navigation-linkhover spanafterbackground-colorffffffmedia4
navigation-linknavigation-link-active-page spanafterbackground-colorffffffmedia4
min-width 30empipdata-tower-id794311a7d32545539af74f15b00c3bcd-0-1-0sandwich4
min-width 30empipdata-tower-id794311a7d32545539af74f15b00c3bcd-0-1-0fill4
min-width 30empipdata-tower-id794311a7d32545539af74f15b00c3bcd-0-1-0border4
color fd43744
min-width 60empipdata-tower-id794311a7d32545539af74f15b00c3bcd-0-1-0fill4
10pxjustify-contentflex-startmedia screen4
10px 10pxjustify-contentflex-startmedia4
navigation-link spanhoverborder2px3
nav-children navigation-linknavigation-link-active-pageborder2px3
navigation-linknavigation-link-active-pageborder2px solid3
nav-children navigation-linkhoverborder2px3
navigation-linkhoverborder2px solid3
solid ffffffpipdata-tower-id794311a7d32545539af74f15b00c3bcd-0-1-0border3
spanhoverborder2px solid3
min-width 60emblockblock3
spanborder2px solid3
navigation-linknavigation-link-active-page spanborder2px3
0border-leftsolid 0003
000 0border-leftsolid3
0border-bottomsolid 0003
000 0border-bottomsolid3
0border-rightsolid 0003
000 0border-rightsolid3
opacity 073
rich-text-editable-content opacity3
color 3636363
desktoplinks nav-childrennav-childrennav-childrennav-childrennav-children3
screen59
min-width59
025
10px21
link17
navigation-linknavigation-link-active-page15
solid12
nav-children12
notnav-children12
00012
navigation-linkhover10
0media8
color8
spanafterbackground-colorffffffmedia8
ffffffmedia8
desktoplinks6
navigation-link6
30empipdata-tower-id794311a7d32545539af74f15b00c3bcd-0-1-0border4
30empipdata-tower-id794311a7d32545539af74f15b00c3bcd-0-1-0fill4
60empipdata-tower-id794311a7d32545539af74f15b00c3bcd-0-1-0fill4
pipdata-tower-id794311a7d32545539af74f15b00c3bcd-0-1-04
60empipdata-tower-id794311a7d32545539af74f15b00c3bcd-0-1-0border4
spanbeforebackground-colorffffffmedia4
60empipdata-tower-id794311a7d32545539af74f15b00c3bcd-0-1-0sandwich4
30empipdata-tower-id794311a7d32545539af74f15b00c3bcd-0-1-0sandwich4
10pxjustify-contentflex-startmedia4
fd43744
nav-childrennav-childrennav-childrennav-childrennav-children3
60emblockblock3
13
navigation-linkhoverborder2px3
navigation-linknavigation-link-active-pageborder2px3
rich-text-editable-container3
spanhoverborder2px3
rich-text-editable-content3
ffffffpipdata-tower-id794311a7d32545539af74f15b00c3bcd-0-1-0border3
opacity3
073
0border-rightsolid3
0border-bottomsolid3
spanborder2px3
0border-leftsolid3
mobile-contentactive3

Who hosts Michellefiore.org?

Michellefiore.org Hosting Provider Information

Hosted IP Address:104.17.201.73
Hosted Hostname:104.17.201.73
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "CloudFlare, Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.7948%
GoDaddy.com, LLC
8.0700%
Namecheap, Inc.
4.0119%
Confluence Networks Inc
2.6770%
Fara Negar Pardaz Khuzestan
2.1305%
Google Inc.
2.1184%
Merit Network Inc.
1.8272%
1&1 Internet AG
1.8076%
Cogent Communications
1.7178%
CloudFlare, Inc.
1.6296%

HTTP Header Analysis for Michellefiore.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 27 Mar 2021 06:26:18 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Content-Language: en_us
Cache-Control: public, s-maxage=43200, max-age=60
CF-Cache-Status: MISS
cf-request-id: 0913f5bd69000053e6aba81000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Vary: Accept-Encoding
Server: cloudflare
CF-RAY: 63668bdbd93f53e6-LHR
Content-Encoding: gzip

Michellefiore.org Domain Nameserver Information

HostIP AddressCountry
maya.ns.cloudflare.com 108.162.192.194
logan.ns.cloudflare.com 108.162.193.198


Need to find out who hosts Michellefiore.org?


Domain Registration (WhoIs) information for Michellefiore.org

 Domain Name: MICHELLEFIORE.ORG
Registry Domain ID: D187462922-LROR
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucows.com
Updated Date: 2021-03-15T04:36:50Z
Creation Date: 2016-04-13T22:23:06Z
Registry Expiry Date: 2022-04-13T22:23:06Z
Registrar Registration Expiration Date:
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4165350123
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registrant Organization: VistaPrint Technologies Ltd
Registrant State/Province:
Registrant Country: BM
Name Server: MAYA.NS.CLOUDFLARE.COM
Name Server: LOGAN.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2021-03-27T06:25:18Z

Websites with Similar Names

Miche-bag.eu
MICHE Bag - Eine Tasche, flexible Styles - MICHE Bag
Miche-bags-london.online
Welcome to your new website
Miche-university.com
Miche University | Get your Miche education!
Miche.com
miche.com
Miche.design
miche.design - Registered at Namecheap.com
Miche.it
Miche | Ciclismo dal 1919 | Miche We Race Together

Recently Updated Websites

Coacherpreneur.net (1 second ago.)Exploracentre.com (3 seconds ago.)Sellingthegardens.com (3 seconds ago.)Klap-entertainment.com (4 seconds ago.)Ybvip1796.app (4 seconds ago.)Starcanaveral.es (4 seconds ago.)Onsiteec.net (4 seconds ago.)Constructiondocumentservices.com (5 seconds ago.)Sunflowersshop.com (5 seconds ago.)Excel-vba.com (5 seconds ago.)Five22brownies.com (6 seconds ago.)Nkmmysurpastore.net (6 seconds ago.)Seattlesleepsolutions.net (6 seconds ago.)Thebestfreelancemarketing.com (6 seconds ago.)Jinyangwx.com (6 seconds ago.)Jhygjzs.com (7 seconds ago.)Paimon.net (7 seconds ago.)Michigantrainingacademy.com (7 seconds ago.)Filatic.ro (8 seconds ago.)Rworks.tokyo (8 seconds ago.)Studyenglishservices.com (8 seconds ago.)Talkiteasy.net (8 seconds ago.)Valhalladesignarg.com (9 seconds ago.)47a66.com (9 seconds ago.)Innvisionled.com (9 seconds ago.)Liyolcoach.com (10 seconds ago.)Inteliwelder.com (10 seconds ago.)Jnjmsh.com (11 seconds ago.)Closeoutsweatshirts.com (11 seconds ago.)Ysmbike.com (12 seconds ago.)

Recently Searched Keywords

스코워 (1 second ago.)istrobanka – obnova plus (1 second ago.)style-k3p94c6slabel (2 seconds ago.)chandelle de soya chaï latte (2 seconds ago.)하이어 파워 highe… (5 seconds ago.)semi rural location (7 seconds ago.)이토렌트 (7 seconds ago.)the times of india (7 seconds ago.)성인용품구매 (9 seconds ago.)hakb02-10 hakb02-14 (10 seconds ago.)토렌트씨 (10 seconds ago.)internet address (10 seconds ago.)60000 kdv (10 seconds ago.)atheistinfo (11 seconds ago.)6 elements of music (13 seconds ago.)zi noapte (14 seconds ago.)3 words for paris (15 seconds ago.)조이맥심 (15 seconds ago.)스포츠정보 (16 seconds ago.)megacontrol akku (16 seconds ago.)straight boy bedroom boredom leads to porn watching wank session (17 seconds ago.)그 남자의 집 his house 2020 1080p kor hevc aac rtm (17 seconds ago.)официальный дилер лифан в москве (18 seconds ago.)happy clients (18 seconds ago.)balneare (19 seconds ago.)parliment funkadelic (19 seconds ago.)jn三国演义me (20 seconds ago.)hotel murah singapura (21 seconds ago.)담보 pawn 2020 1080p fhdrip h264 aac nondrm (21 seconds ago.)오르가즘자극용 (22 seconds ago.)