Microsoft-press.de  |  Microsoft Press Buch Shop: Microsoft Bücher zu Microsoft Software
Low trust score  | 
Gutes Buch zu Microsoft Software? Microsoft Press Shop (by edv-buchversand.de) liefert portofrei & meist über Nacht Microsoft Bücher vom Microsoft-Press Verlag (Kurzform ms press). Windows 8.1 Buch, Office 2013 Buch, Word 2013 Buch, Excel 2013 Buch, Microsoft Visual Studio Buch, Microsoft Windows Server Buch.

Microsoft-press.de Website Information

Microsoft-press.de has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 933,305, a Majestic Rank of 745,132, a Domain Authority of 45% and is listed in DMOZ.

Microsoft-press.de is hosted by TELUS Communications Inc. in Bayern, Nuremberg, Germany, 90455.
Microsoft-press.de has an IP Address of 5.9.216.100 and a hostname of www.microsoft-press.de.

The domain microsoft-press.de was registered 201 decades 8 years 9 months ago by , it was last modified 6 years 5 months 2 weeks ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for microsoft-press.de

Full Whois Lookup for Microsoft-press.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: microsoft-press.de
Nserver: dns01.edv-buchversand.de
Nserver: dns02.edv-buchversand.de
Status: connect
Changed: 2015-05-17T12:06:29+02:00

[Tech-C]
Type: PERSON
Name: Host Master
Organisation: united-domains AG
Address: Gautinger Str. 10
PostalCode: 82319
City: Starnberg
CountryCode: DE
Phone: +49.8151368670
Fax: +49.81513686777
Email: Login to show email
2013-02-01T14:11:16+01:00

[Zone-C]
Type: PERSON
Name: Host Master
Organisation: united-domains AG
Address: Gautinger Str. 10
PostalCode: 82319
City: Starnberg
CountryCode: DE
Phone: +49.8151368670
Fax: +49.81513686777
Email: Login to show email
2013-02-01T14:11:15+01:00

Who hosts Microsoft-press.de?

Microsoft-press.de Web Server Information

Hosted IP Address:5.9.216.100
Hosted Hostname:www.microsoft-press.de
Service Provider:TELUS Communications Inc.
Hosted Country:GermanyDE
Location Latitude:49.4478
Location Longitude:11.0683
Webserver Software:Not Applicable

HTTP Header Analysis for Microsoft-press.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Mon, 25 May 2015 17:16:24 GMT
Content-Type: text/html; charset=ISO-8859-1
Transfer-Encoding: chunked
X-Powered-By: PHP/5.5.9-1ubuntu4.9
P3P: CP="IDC DSP COR CURa ADMa OUR IND PHY ONL COM STA"
Cache-Control: private
Expires: Mon, 25 May 2015 17:16:24 GMT
Last-Modified: Mon, 25 May 2015 17:16:24 GMT
Content-Encoding: gzip


Need to find out who hosts Microsoft-press.de?

Microsoft-press.de Free SEO Report

Website Inpage Analysis for Microsoft-press.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Microsoft-press.de

scrofx windowpagexoffsetvar size thisidgetsizescrollparseintobjclientheightchecken varfunction axposabigscreenvideosrcscrofy documentdocumentelementscrolltop scrofx0 scrofy 0objaddit 15iftypeof wininnerwidththiswindowheight parseintobjclientheightcheckenifthiswindowwidth 1280500 varifdocumentgetelementbyidrightskyscraper14if documentdocumentelement documentdocumentelementscrollleftheartbeatanewtop scrofy80 px0980 px globaldeliverycostdetailsstyleopacity0globaldeliverycostdetailsstyleleft999pxreturn18thiswindowwidth wininnerwidth varasearchcattitleul1px solid cacacaif typeofsofortanewheightwins0 widthvar bodyrightabsolutevar anewtopaheightcompliant scrofyvideoinnerboxstylewidth11alertaxpos1px 1pxsizex 2 150ayposglobalnodeliverycostdetailsstyleopacity0 globalnodeliverycostdetailsstyleleft999px globalnodeliverycostdetailsstyletop999pxs0theoldheightaypos thisidgetpositionyelsebackground1000 elsetpropertyidinfinite normalborder 1px solidasource theimagewidthaddit 15 ifthiswindowwidththedivstyledisplay noneelse varspezialist fr microsoftpresskategorienav lihovertheoldvideoheightvar anewtop scrofyaxposlargepadding 0asearchcattitleli widthwindowinnerwidth var winihr55pxvar winihr spezialist frvar objtheoldwidthifthedivstyledisplaydocumentdocumentelementscrollleft documentdocumentelementscrolltopanewheight 980 aheightthiswindowheighttextdecoration0svideoinnerboxstyleheight50 ifaxposlargeulscale6 transformifaxposlarge bodyrightaxposrepeat scroll 0ihr spezialistifwindowpagexoffsetvar bodyright bodywidthnumbervar thiswindowheight wininnerheight2theoldtopthiswindowheight wininnerheightscrofycompliantvideoinnerboxstyleleftanewtop980 aheight awidth2 1000lineheightdocumentbody documentbodyscrollleftdisplay block2 700 aypos1px solidatopofftypeofmarginwindowpageyoffset scrofxundefined var thiswindowwidththeimageheightdocumentdocumentelementscrollleft6thisidgetsizewindowgetsizex varzindexgetbodywin var thiswindowwidthrotate4degglobaldeliverycostdetailsstyletop999pxthisidgetpositionxeladdeventmouseover function300 50 ifaxposlargevideoinnerboxstylesetpropertytopdocumentbody documentbodyscrollleft documentbodyscrolltopfontsizetheoldvideotopvar bodywidth windowgetsizexwininnerwidth var15 ifthiswindowwidthwin window iftypeofif documentbody documentbodyscrollleft2s ease0 if typeoffr sienone repeatspezialist fr22pxvar win windowbchervar obj getbodywinacomputedheight2 axposlarge axposposition relativeaxpos 300obj getbodywin var12rgba00 0 150scrofy 0 ifthediv1styledisplay blockscrofy documentbodyscrolltop scrofxaxpos2 axposlargebodywidth 1000 2rotate4deg scale6versandbodyright bodywidth 1000thedivinnerhtml2 150 alertaxposaxpos sizex 2scrofy windowpageyoffset scrofxbodywidth windowgetsizex varhomethediv1styledisplaynone thedivstyledisplay block0alefoffwindowpagexoffset else1280 vardocumentbodyscrollleft else ifvar scrofxscrofy documentdocumentelementscrolltoppx globaldeliverycostdetailsstyleopacity0 globaldeliverycostdetailsstyleleft999pxwininnerwidth undefinedvideoinnerboxstyletop980px 500heightreturn falsewininnerwidthvar addit 15150 windowsettimeoutthisprefixsize thisidgetsizescrofy windowpageyoffsetbodyheightnone thediv1styledisplay nonefunction5pxvar thiswindowwidth windowinnerwidthrightparseintobjclientheight var additwindowpageyoffset numberelse if documentdocumentelementscroll 0 0nonewidth 60pxawidth700 aypos thisidgetpositionyglobaldeliverycostdetailsstyleopacity0 globaldeliverycostdetailsstyleleft999px globaldeliverycostdetailsstyletop999pxthiswindowwidth windowinnerwidth8globaldeliverycostdetailsstyletop999px globalnodeliverycostdetailsstyleopacity0wininnerwidth undefined varautothediv1styledisplay none15 ifthiswindowwidth 1280function axpos thisidgetpositionxscrofx documentbodyscrollleft elsescrofx documentdocumentelementscrollleftaxposlarge axposbodywidthelse var objgetbodywin varaleftposawidth anewheightdocumentbodyrgba0 0 0spezialist0 vartelephone170 else var60pxaypos 80 pxtheheight5scrofy 0var thiswindowwidth parseintobjclientwidthscroll 099 11wininnerheightvar sizethedivstyledisplay block thediv1styledisplay980pxvar thiswindowwidthelse if documentbodytheoldpaddingglobalnodeliverycostdetailsstyleleft999px0 150colorasourcedocumentbodyscrolltopaxpos axposelsetpropertyiddocumentdocumentelementtypeof windowpageyoffsetthiswindowwidth windowinnerwidth varparseintobjclientheight varwebkittransform1000 2bildschirmfffeasescrofx documentbodyscrollleftthiswindowwidthrepeatscale6infiniteborderaxpos thisidgetpositionx axposthisidgetpositionx axpos axposaxpos axpos bodywidthglobalnodeliverycostdetailsstyletop999pxfalse1s1 500fr microsoftpress2 varundefined varwininnerheight var additsizevar bodywidthadditfrdiextheimagewidththisidgetpositionyscrofx2 150bodyrightaxposnone thedivstyledisplaydocumentbodyscrollleft elsebildschirm checken varawidth anewheight mathflooranewheight2 700axpos bodywidthwidth 10emmakefullscreenaypos 80bodyrightaxpos bodywidth 1000userdropdownfontweightnone repeat scrollwindowgetsizexversandkosteneladdeventmouseover function axposundefinedwin windowvar thiswindowwidth wininnerwidthwininnerwidth var additwindow300 50obj getbodywin1000 2 axposlargeparseintobjclientwidth24pxdocumentbodyscrolltop scrofx documentbodyscrollleftanewheight mathflooranewheightrelativeanewheight 980thedivstyledisplay15windowgetsizex var bodyright11 6620sizex 212 var sizethiswindowwidth wininnerwidthtextdecoration nonergba0 0thedivstyledisplay none thediv1styledisplayvar addit 00 ifwiriftypeof wininnerwidth undefinedkategorienav lileftsizexglobaldeliverycostdetailsstyleleft999px globaldeliverycostdetailsstyletop999pxwidthparseintobjclientwidth varif documentdocumentelementpersonalizeifthiswindowwidth 1280 var2s3bildschirm checkendocumentdocumentelement documentdocumentelementscrollleftscrofx 08 150theoldleftthiswindowwidth parseintobjclientwidthpx globaldeliverycostdetailsstyleopacity01000 2 700scrofy documentbodyscrolltopvideoinnerboxstylepositionaxpos axpos sizexaheight awidth anewheight13parseintobjclientwidth var addit0 important700 ayposblock thediv1styledisplay blockgetbodywinwindowinnerwidth vartheoldpositionifthiswindowwidthvar additdembodyrightaxpos bodywidthmicrosoftpress bcher9documentdocumentelementscrolltopmargin 0addit 0floatsie10emscrofx 0 scrofy0 0 0topthepositionimportantwindowpageyoffset scrofx windowpagexoffset0 8 1500 scrofyaleftthiswindowheight wininnerheight varwinnone thediv1styledisplay10else ifaxpos sizex0 elseblock thediv1styledisplaytypeof windowpageyoffset numberuhraheight awidthpositionglobalnodeliverycostdetailsstyleleft999px globalnodeliverycostdetailsstyletop999pxblockifthedivstyledisplay none thedivstyledisplay50 ifaxposlarge bodyrightaxposthisidgetpositionx axposnormalfr dieglobaldeliverycostdetailsstyletop999px globalnodeliverycostdetailsstyleopacity0 globalnodeliverycostdetailsstyleleft999pxifthedivstyledisplay nonescale1transformtheimagewidth theimageheightkategorienavcacacaanewheightdisplaymathflooranewheightposition absoluteeladdeventmouseoverdocumentbodyscrollleft documentbodyscrolltopdocumentbodyscrollleft0 099 11 66var thiswindowheightbodywidth windowgetsizexacontentnbsp42 1000 elsetpropertyid150 alertaxposwininnerheight varglobaldeliverycostdetailsstyleleft999px globaldeliverycostdetailsstyletop999px globalnodeliverycostdetailsstyleopacity0scrofx windowpagexoffset elseasource theimagewidth theimageheightdocumentdocumentelement documentdocumentelementscrollleft documentdocumentelementscrolltopdocumentbodyscrolltop scrofxscale115var aleftposvar16bodyright bodywidthaxpos bodywidth 1000thedivstyledisplay block0 8ifaxposlargeiftypeofwindow iftypeofglobaldeliverycostdetailsstyleopacity0soliduserdropdown likrepeat scrollsinddocumentdocumentelementscrolltop scrofxglobaldeliverycostdetailsstyleopacity0 globaldeliverycostdetailsstyleleft999pxsolid cacacawindow iftypeof wininnerwidthbodyrightwindowsettimeoutthisprefixwindowinnerwidthdocumentdocumentelementscrolltop scrofx documentdocumentelementscrollleftlihover0 150 windowsettimeoutthisprefix15pxthiswindowwidth parseintobjclientwidth varchecken var scrofxzufr microsoftpress bcherservicevar thiswindowheight parseintobjclientheightborder 1pxifaxposlarge bodyrightaxpos bodywidthasearchcattitlelibackground fff980 aheight1000 2 varglobalnodeliverycostdetailsstyleopacity0 globalnodeliverycostdetailsstyleleft999pxaxposlarge axpos 300px30pxease 0s19addit 0 elseaxpos thisidgetpositionxlifloat leftmicrosoftpressif documentbody1pxif typeof windowpageyoffset0 0 81000 2 1000globalnodeliverycostdetailsstyleopacity0var scrofx 0windowpageyoffset7bodywidth 1000axpos 300 50windowpagexoffset else ifpadding

Longtail Keyword Density for Microsoft-press.de

KeywordsOccurences
bodywidth 1000 223
rgba0 0 011
axpos axpos bodywidth9
axpos bodywidth 10009
var bodywidth windowgetsizex8
bodywidth windowgetsizex var7
var win window7
else var obj7
var obj getbodywin7
obj getbodywin var7
var addit 156
wininnerwidth undefined var6
0 else var6
iftypeof wininnerwidth undefined6
addit 0 else6
var addit 06
windowgetsizex var bodyright6
axpos thisidgetpositionx axpos6
0 0 86
thisidgetpositionx axpos axpos6
win window iftypeof6
1000 2 10006
var bodyright bodywidth6
bodyright bodywidth 10006
thiswindowwidth parseintobjclientwidth var5
2 1000 elsetpropertyid5
getbodywin var thiswindowwidth5
window iftypeof wininnerwidth5
undefined var thiswindowwidth5
windowinnerwidth var win5
var thiswindowwidth parseintobjclientwidth5
border 1px solid5
var thiswindowwidth windowinnerwidth5
var thiswindowwidth wininnerwidth5
thiswindowwidth windowinnerwidth var5
thiswindowwidth wininnerwidth var5
1000 2 var4
block thediv1styledisplay block4
0 8 1504
var anewtop scrofy4
ifaxposlarge bodyrightaxpos bodywidth4
bodyrightaxpos bodywidth 10004
1000 2 7004
thedivstyledisplay block thediv1styledisplay4
700 aypos thisidgetpositiony4
wininnerheight var addit4
var size thisidgetsize4
axpos 300 504
none thedivstyledisplay block4
ifthedivstyledisplay none thedivstyledisplay4
2 700 aypos4
aypos 80 px4
15 ifthiswindowwidth 12804
axposlarge axpos 3004
addit 15 ifthiswindowwidth4
function axpos thisidgetpositionx4
eladdeventmouseover function axpos4
1000 2 axposlarge4
2 axposlarge axpos4
thiswindowheight wininnerheight var3
if documentdocumentelement documentdocumentelementscrollleft3
documentdocumentelement documentdocumentelementscrollleft documentdocumentelementscrolltop3
var thiswindowheight wininnerheight3
else if documentdocumentelement3
documentdocumentelementscrolltop scrofx documentdocumentelementscrollleft3
scrofy documentdocumentelementscrolltop scrofx3
scrofy documentbodyscrolltop scrofx3
if documentbody documentbodyscrollleft3
else if documentbody3
documentbody documentbodyscrollleft documentbodyscrolltop3
wininnerwidth var addit3
scrofx documentbodyscrollleft else3
documentbodyscrolltop scrofx documentbodyscrollleft3
documentbodyscrollleft else if3
fr microsoft-press bcher3
thedivstyledisplay none thediv1styledisplay3
repeat scroll 03
none thediv1styledisplay none3
0 0 03
0 150 windowsettimeoutthisprefix3
0 0 1503
scroll 0 03
1px solid cacaca3
ifthiswindowwidth 1280 var3
parseintobjclientheight var addit3
windowpagexoffset else if3
spezialist fr microsoft-press3
99 11 663
ihr spezialist fr3
var thiswindowheight parseintobjclientheight3
if typeof windowpageyoffset3
axpos axpos sizex3
globalnodeliverycostdetailsstyleopacity0 globalnodeliverycostdetailsstyleleft-999px globalnodeliverycostdetailsstyletop-999px3
axpos sizex 23
sizex 2 1503
parseintobjclientwidth var addit3
2 150 alertaxpos3
globaldeliverycostdetailsstyletop-999px globalnodeliverycostdetailsstyleopacity0 globalnodeliverycostdetailsstyleleft-999px3
globaldeliverycostdetailsstyleleft-999px globaldeliverycostdetailsstyletop-999px globalnodeliverycostdetailsstyleopacity03
50 ifaxposlarge bodyrightaxpos3
300 50 ifaxposlarge3
none repeat scroll3
80 px globaldeliverycostdetailsstyleopacity03
globaldeliverycostdetailsstyleopacity0 globaldeliverycostdetailsstyleleft-999px globaldeliverycostdetailsstyletop-999px3
px globaldeliverycostdetailsstyleopacity0 globaldeliverycostdetailsstyleleft-999px3
2 var size3
asource theimagewidth theimageheight3
scrofy 0 if3
0 scrofy 03
0 if typeof3
typeof windowpageyoffset number3
windowpageyoffset scrofx windowpagexoffset3
scrofy windowpageyoffset scrofx3
scrofx 0 scrofy3
var scrofx 03
980 aheight awidth3
anewheight 980 aheight3
aheight awidth anewheight3
awidth anewheight mathflooranewheight3
checken var scrofx3
bildschirm checken var3
scrofx windowpagexoffset else3
1000 223
bodywidth 100023
0 019
var thiswindowwidth15
var addit13
axpos axpos12
0 15012
rgba0 011
else var9
axpos bodywidth9
bodywidth windowgetsizex8
var bodywidth8
var win7
win window7
undefined var7
asearchcattitleli width7
obj getbodywin7
var obj7
var thiswindowheight7
getbodywin var7
windowgetsizex var7
1px solid7
window iftypeof6
else if6
addit 06
iftypeof wininnerwidth6
2 10006
wininnerwidth undefined6
0 else6
s0 width6
thisidgetpositionx axpos6
addit 156
parseintobjclientwidth var6
0 86
axpos thisidgetpositionx6
wininnerwidth var6
var bodyright6
bodyright bodywidth6
thiswindowwidth parseintobjclientwidth5
thiswindowwidth wininnerwidth5
eladdeventmouseover function5
aypos thisidgetpositiony5
border 1px5
2 var5
windowinnerwidth var5
1 5005
0 important5
1000 elsetpropertyid5
thiswindowwidth windowinnerwidth5
aypos 804
function axpos4
80 px4
var size4
size thisidgetsize4
700 aypos4
2 7004
axpos 3004
axposlarge axpos4
300 504
background fff4
bodyrightaxpos bodywidth4
ifaxposlarge bodyrightaxpos4
2 axposlarge4
ifthiswindowwidth 12804
500 var4
margin 04
thediv1styledisplay block4
block thediv1styledisplay4
thedivstyledisplay block4
var anewtop4
anewtop scrofy4
compliant scrofy4
position absolute4
wininnerheight var4
150 windowsettimeoutthisprefix4
microsoft-press bcher4
8 1504
ifthedivstyledisplay none4
1280 var4
rotate4deg scale64
15 ifthiswindowwidth4
infinite normal4
none thedivstyledisplay4
2s ease4
scale6 transform4
rotate-4deg scale64
documentbody documentbodyscrollleft3
if documentbody3
0 if3
documentbodyscrollleft documentbodyscrolltop3
windowpagexoffset else3
documentbodyscrolltop scrofx3
scrofy documentbodyscrolltop3
scrofy windowpageyoffset3
windowpageyoffset number3
return false3
typeof windowpageyoffset3
if typeof3
windowpageyoffset scrofx3
scrofx windowpagexoffset3
thiswindowheight wininnerheight3
thedivstyledisplay none3
scrofx documentdocumentelementscrollleft3
980px 5003
parseintobjclientheight var3
thiswindowheight parseintobjclientheight3
scrofy 03
documentdocumentelementscrolltop scrofx3
scrofy documentdocumentelementscrolltop3
if documentdocumentelement3
documentbodyscrollleft else3
documentdocumentelement documentdocumentelementscrollleft3
thediv1styledisplay none3
documentdocumentelementscrollleft documentdocumentelementscrolltop3
none thediv1styledisplay3
scrofx documentbodyscrollleft3
50 ifaxposlarge3
spezialist fr3
ihr spezialist3
11 663
99 113
fr microsoft-press3
1px 1px3
var aleftpos3
kategorienav lihover3
kategorienav li3
width 10em3
position relative3
display block3
solid cacaca3
scroll 03
repeat scroll3
none repeat3
padding 03
text-decoration none3
userdropdown li3
width 60px3
float left3
ease 0s3
0 var3
px globaldeliverycostdetailsstyleopacity03
aheight awidth3
980 aheight3
anewheight 9803
theimagewidth theimageheight3
awidth anewheight3
anewheight mathflooranewheight3
scrofx 03
var scrofx3
checken var3
bildschirm checken3
asource theimagewidth3
fr sie3
globalnodeliverycostdetailsstyleopacity0 globalnodeliverycostdetailsstyleleft-999px3
globaldeliverycostdetailsstyletop-999px globalnodeliverycostdetailsstyleopacity03
globaldeliverycostdetailsstyleleft-999px globaldeliverycostdetailsstyletop-999px3
globaldeliverycostdetailsstyleopacity0 globaldeliverycostdetailsstyleleft-999px3
globalnodeliverycostdetailsstyleleft-999px globalnodeliverycostdetailsstyletop-999px3
axpos sizex3
fr die3
150 alertaxpos3
2 1503
sizex 23
0 scrofy3
var129
084
axpos41
bodywidth35
132
230
px28
width26
important25
else24
none22
function20
319
scrofy16
thiswindowwidth16
block15
1px15
addit15
thiswindowheight13
fr13
wininnerwidth12
scrofx12
rgba011
411
position10
aypos10
left10
kategorienav10
top9
59
anewheight9
if9
die8
-webkit-transform8
scale68
windowgetsizex8
68
78
anewtop8
li8
padding8
background8
height8
thediv1styledisplay7
windowsettimeoutthisprefix7
win7
window7
obj7
solid7
asource7
getbodywin7
87
undefined7
asearchcattitleli7
thedivstyledisplay7
s07
iftypeof7
5px6
thisidgetpositionx6
userdropdown6
ul6
bodyright6
color6
x6
compliant6
96
parseintobjclientwidth6
theoldpadding6
fff6
theoldleft6
theoldtop6
windowpageyoffset6
theoldposition6
transform6
theoldheight6
documentdocumentelementscrollleft6
theoldwidth6
documentdocumentelementscrolltop6
normal6
documentbodyscrolltop6
documentbodyscrollleft6
acontent5
aleft5
thedivinnerhtml5
border5
sizex5
versandkosten5
aheight5
awidth5
alertaxpos5
wininnerheight5
105
eladdeventmouseover5
thisidgetpositiony5
095
115
elsetpropertyid5
ifthiswindowwidth5
sie5
heartbeat5
telephone5
return5
bodyheight5
bcher5
videoinnerboxstyleheight5
ease5
windowinnerwidth5
videoinnerboxstylewidth5
size4
124
theheight4
parseintobjclientheight4
ifthedivstyledisplay4
margin4
rotate4deg4
versand4
personalize4
microsoft-press4
ihr4
font-weight4
134
22px4
scroll4
thisidgetsize4
font-size4
rotate-4deg4
anewheightwin4
videoinnerboxstyleposition4
false4
auto4
1s4
absolute4
15px4
k4
144
infinite4
2s4
bodyrightaxpos4
axposlarge4
ifaxposlarge4
typeof3
number3
videoinnerboxstyleleft3
videoinnerboxstylesetpropertytop3
makefullscreen3
abigscreenvideosrc3
windowpagexoffset3
atopoff3
videoinnerboxstyletop3
alefoff3
theoldvideotop3
documentdocumentelement3
980px3
acomputedheight3
theoldvideoheight3
documentbody3
aleftpos3
153
spezialist3
163
173
zu3
55px3
scale13
sind3
183
193
scale1153
relative3
display3
text-decoration3
right3
cacaca3
repeat3
0s3
z-index3
60px3
line-height3
float3
asearchcattitleul3
service3
30px3
wir3
dem3
uhr3
sofort3
nbsp3
theimagewidth3
bildschirm3
mathflooranewheight3
203
theimageheight3
theposition3
globalnodeliverycostdetailsstyletop-999px3
ifdocumentgetelementbyidrightskyscraper3
lihover3
10em3
24px3
home3
globaldeliverycostdetailsstyleopacity03
globalnodeliverycostdetailsstyleleft-999px3
globalnodeliverycostdetailsstyleopacity03
globaldeliverycostdetailsstyletop-999px3
globaldeliverycostdetailsstyleleft-999px3
checken3

What are the nameservers for microsoft-press.de?

Microsoft-press.de Domain Nameserver Information

HostIP AddressCountry
dns01.edv-buchversand.de 5.9.26.205Germany Germany
dns02.edv-buchversand.de 5.9.225.113Germany Germany

Microsoft-press.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Microsoft-press.de is a scam?