Midlakes.org

Checking...
Midlakes Schools / Screaming Eagles Homepage
Low trust score
Add a review Change category Claim this site
The Phelps-Clifton Springs Central School District is home to the Midlakes Screaming Eagles.


Domain summary

Domain label
midlakes
Domain extension
org
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is midlakes.org ranked relative to other sites:

Percentage of visits to midlakes.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Midlakes.org registered?
A: Midlakes.org was registered 2 weeks, 3 days, 4 hours, 21 minutes, 16 seconds ago on Sunday, September 6, 2020.
Q: When was the WHOIS for Midlakes.org last updated?
A: The WHOIS entry was last updated 2 weeks, 3 days, 4 hours, 21 minutes, 16 seconds ago on Sunday, September 6, 2020.
Q: Who is the registrar for the Midlakes.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Midlakes.org?
A: Midlakes.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Midlakes.org each day?
A: Midlakes.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Midlakes.org resolve to?
A: Midlakes.org resolves to the IPv4 address .
Q: In what country are Midlakes.org servers located in?
A: Midlakes.org has servers located in the .
Q: What webserver software does Midlakes.org use?
A: Midlakes.org is powered by Microsoft-IIS/8.5 webserver.
Q: Who hosts Midlakes.org?
A: Midlakes.org is hosted by Unknown in .
Q: How much is Midlakes.org worth?
A: Midlakes.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Midlakes.org?

Midlakes.org Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Microsoft-IIS/8.5

Is "" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Midlakes.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 06 Sep 2020 23:16:43 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Cache-Control: private
Content-Encoding: gzip
Vary: Accept-Encoding
Server: Microsoft-IIS/8.5
Strict-Transport-Security: max-age=31536000; includeSubDomains;
X-XSS-Protection: 1; mode=block
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
X-Frame-Options: SAMEORIGIN

Midlakes.org Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Midlakes.org?


WhoIs information for Midlakes.org

 Domain Name: MIDLAKES.ORG
Registry Domain ID: D10875060-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2019-09-03T12:48:12Z
Creation Date: 1999-09-30T14:24:18Z
Registry Expiry Date: 2024-09-30T14:24:14Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Wayne-Finger Lakes BOCES
Registrant State/Province: NY
Registrant Country: US
Name Server: EDNS.EDUTECH.ORG
Name Server: EDNS2.EDUTECH.ORG
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-06-29T18:31:27Z

Midlakes.org Free SEO Report

Website Inpage Analysis for Midlakes.org

H1 Headings

23 :
  1. Midlakes Schools
  2. News & Notes
  3. Midlakes Student Does the ‘Right Thing’ 
  4. Superintendent's Message: Midlakes Moves Closer to Sept. 14 Start
  5. Rotary Donates School Supplies 
  6. Midlakes Graduate Receives ‘First in Family’ Scholarship
  7. Photo Galleries
  8. District Videos
  9. Simple Steps to Start the New School Year
  10. Midlakes Raises $4K for Relay for Life
  11. Midlakes Class of 2020 Graduates
  12. Midlakes Virtua (Indoor) Graduation Ceremony
  13. Midlakes High School Virtual Awards Ceremony
  14. Sixth-grade Send-off
  15. Midlakes 7 & 8 Grade Awards
  16. Midlakes Elementary School Awards
  17. Midlakes National Honor Society Induction Ceremony
  18. Quick Links
  19. District Calendar
  20. Tomorrow
  21. Tuesday
  22. Wednesday
  23. Follow Us

H2 Headings

1 :
  1. Let's Connect:

H3 Headings

2 :
  1. Find Us
  2. Find it Fast

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

15 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-129795023-1

Links - Internal

184:
  1. District Home
    https://www.midlakes.org/Domain/4
  2. Sign In
    https://www.midlakes.org/site/Default.aspx?PageType=7&SiteID=4&IgnoreRedirect=true
  3. Home
    http://midlakes.org/Page/1
  4. Departments
    http://midlakes.org/domain/2048
  5. Technology
    http://midlakes.org/domain/24
  6. Emergency Plan
    http://midlakes.org/domain/2116
  7. 2019-2020 Photo Galleries
    http://midlakes.org/domain/2128
  8. 2018-2019 Photo Galleries
    http://midlakes.org/domain/2089
  9. Home Instruction
    http://midlakes.org/domain/2155
  10. Employee Portal
    http://midlakes.org/domain/2161
  11. Superintendent
    http://midlakes.org/domain/2048
  12. Business Office
    http://midlakes.org/domain/19
  13. Buildings & Grounds
    http://midlakes.org/domain/2051
  14. Communications
    http://midlakes.org/domain/2077
  15. Food Service
    http://midlakes.org/domain/29
  16. Health & Nursing
    http://midlakes.org/domain/2050
  17. Human Resources
    http://midlakes.org/domain/2049
  18. Instruction
    http://midlakes.org/domain/2054
  19. Special Programs & Services Office
    http://midlakes.org/domain/2053
  20. Transportation
    http://midlakes.org/domain/2052
  21. Innovation & Professional Learning
    http://midlakes.org/domain/2122
  22. Schools
    http://midlakes.org/domain/16
  23. Calendar
    https://www.midlakes.org/site/Default.aspx?PageID=2#calendar1/20181203/month
  24. Closings & Delays Info
    http://midlakes.org/domain/2067
  25. Library Media Center
    http://midlakes.org/domain/2094
  26. Back to School
    http://midlakes.org/domain/2125
  27. Kindergarten Pre-Registration
    https://www.midlakes.org/cms/module/selectsurvey/TakeSurvey.aspx?SurveyID=118
  28. Elementary School
    http://midlakes.org/domain/16
  29. Forms
    http://midlakes.org/domain/2159
  30. Middle/High School
    http://midlakes.org/domain/14
  31. Morning Announcements
    http://midlakes.org/domain/2130
  32. Scholarship Info
    https://www.midlakes.org/Page/4473
  33. Staff Directory
    http://midlakes.org/domain/2061
  34. Work-Based Learning
    http://midlakes.org/domain/2138
  35. Graduation 2020
    http://midlakes.org/domain/2163
  36. Staff Tools
    https://www.midlakes.org/domain/2061
  37. COPPA List
    http://midlakes.org/domain/2105
  38. SchoolTool Tutorial
    http://midlakes.org/domain/2100
  39. Staff Directory
    https://www.midlakes.org/domain/2061
  40. APPR Plan
    http://midlakes.org/site/Default.aspx?PageID=3204
  41. K-6 Links
    http://midlakes.org/domain/2090
  42. SchoolTool
    http://midlakes.org/https:\\st.edutech.org\midlakes
  43. Remote Learning Help
    http://midlakes.org/domain/2166
  44. Parents
    http://midlakes.org/domain/2115
  45. Internet Safety
    http://midlakes.org/domain/2068
  46. School Safety
    http://midlakes.org/domain/1051
  47. Acceptable Use Policy
    http://midlakes.org/domain/2115
  48. Change of Address Form
    http://midlakes.org/domain/2146
  49. Code of Conduct
    http://midlakes.org/domain/50
  50. DASA
    http://midlakes.org/domain/40
  51. Get Involved
    http://midlakes.org/domain/1048
  52. Lunch Menus
    http://midlakes.org/site/Default.aspx?PageID=1106
  53. Parent's Bill of Rights
    http://midlakes.org/domain/1053
  54. Remote Learning Help
    http://midlakes.org/site/Default.aspx?PageID=4292
  55. Schoology
    http://midlakes.org/domain/2113
  56. Student Registration
    http://midlakes.org/domain/1052
  57. UPK, K registration
    http://midlakes.org/domain/1055
  58. Athletics
    http://midlakes.org/domain/10
  59. Eagles in Training
    https://www.midlakes.org//cms/module/selectsurvey/TakeSurvey.aspx?SurveyID=119
  60. Winter Rosters
    http://midlakes.org/domain/2098
  61. Spring Rosters
    http://midlakes.org/domain/2118
  62. Basketball Camp
    http://midlakes.org/domain/2119
  63. Wrestling Camp
    http://midlakes.org/domain/2120
  64. XC Invite
    http://midlakes.org/domain/2121
  65. Fall Rosters
    http://midlakes.org/domain/2131
  66. Wrestling Youth Camp
    http://midlakes.org/domain/2144
  67. Aquatics Center
    http://midlakes.org/domain/25
  68. Athletics Home
    https://www.midlakes.org/domain/10
  69. Coaches' Corner
    http://midlakes.org/domain/38
  70. Community Service Form
    http://midlakes.org/domain/2127
  71. Directory
    http://midlakes.org/site/Default.aspx?PageID=1121
  72. Hall of Fame
    http://midlakes.org/domain/27
  73. Schedules
    http://midlakes.org/domain/30
  74. Sports Registration
    http://midlakes.org/site/Default.aspx?PageID=3216
  75. Student-Athletes
    http://midlakes.org/domain/39
  76. Volleyball
    http://midlakes.org/domain/42
  77. Board of Education
    http://midlakes.org/domain/48
  78. Board Candidate Form
    http://midlakes.org/domain/2117
  79. Minutes & Agendas '16
    http://midlakes.org/domain/2108
  80. Minutes & Agendas '17
    http://midlakes.org/domain/2099
  81. Minutes & Agendas '18
    http://midlakes.org/domain/47
  82. Required Disclosures
    http://midlakes.org/domain/2160
  83. Annual Vote
    http://midlakes.org/domain/48
  84. Board Members
    http://midlakes.org/domain/45
  85. Board Policies
    http://midlakes.org/domain/2073
  86. Meeting Dates
    http://midlakes.org/domain/46
  87. Minutes & Agendas
    https://www.midlakes.org/Page/4509
  88. Mission & Vision
    http://midlakes.org/domain/2104
  89. FOIL Requests
    http://midlakes.org/domain/2076
  90. District Safety Plan
    http://midlakes.org/domain/2137
  91. Community
    https://www.midlakes.org/annualvote
  92. Form: Building Use
    http://midlakes.org/site/Default.aspx?PageID=41
  93. Multimedia Page
    http://midlakes.org/domain/2064
  94. Annual Vote
    https://www.midlakes.org/annualvote
  95. Calendar
    http://midlakes.org/site/Default.aspx?PageID=2
  96. Employment
    https://www.midlakes.org/domain/2049
  97. Facility Use Portal
    http://midlakes.org/domain/2123
  98. Graduates of Distinction
    http://midlakes.org/domain/2057
  99. Midlakes Alumni
    http://midlakes.org/domain/2056
  100. Midlakes Journal
    http://midlakes.org/domain/2062
  101. School Tax Info
    http://midlakes.org/domain/2047
  102. Water Tests Results
    http://midlakes.org/domain/2058
  103. One-Room Schoolhouse
    http://midlakes.org/domain/2124
  104. COVID-19 Updates
    http://midlakes.org/domain/2156
  105. Facility Updates
    http://midlakes.org/domain/2134
  106. Submit Comments
    http://midlakes.org/domain/2135
  107. Informational Meetings
    http://midlakes.org/domain/2139
  108. Facilities Updates
    http://midlakes.org/domain/2134
  109. Superintendent's Message
    https://www.midlakes.org/site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=2380&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=8293&PageID=1
  110. Smart Schools Act
    http://midlakes.org/domain/2136
  111. Photos: Current Conditions
    http://midlakes.org/domain/2143
  112. Video: Capital Project Overview
    http://midlakes.org/domain/2145
  113. Strategic Planning
    http://midlakes.org/domain/2151
  114. Parent/Community Survey
    http://midlakes.org/domain/2152
  115. Planning Updates
    http://midlakes.org/domain/2151
  116. Reopening Midlakes
    http://midlakes.org/domain/2167
  117. Reopening Plan
    http://midlakes.org/domain/2167
  118. Contact Tracing
    https://www.midlakes.org/Page/4546
  119. Remote Learning
    https://www.midlakes.org/Page/4544
  120. COVID-19 Testing
    https://www.midlakes.org/Page/4550
  121. Community Resources
    https://www.midlakes.org/Page/4463
  122. COVID-19 Updates
    https://www.midlakes.org/Page/4470
  123. Fact Sheet
    http://midlakes.org/domain/2174
  124. Frequently Asked Questions
    http://midlakes.org/domain/2173
  125. Health & Safety Tips
    http://midlakes.org/domain/2172
  126. Self-Screening Form
    https://www.midlakes.org/Page/4541
  127. Midlakes Student Does the ‘Right Thing’ 
    http://midlakes.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=2380&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=9238&PageID=1
  128. Comments (-1)
    http://midlakes.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=2380&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=9238&PageID=1&Comments=true
  129. Superintendent's Message: Midlakes Moves Closer to Sept. 14 Start
    http://midlakes.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=2380&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=9235&PageID=1
  130. Comments (-1)
    http://midlakes.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=2380&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=9235&PageID=1&Comments=true
  131. Rotary Donates School Supplies 
    http://midlakes.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=2380&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=9225&PageID=1
  132. Comments (-1)
    http://midlakes.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=2380&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=9225&PageID=1&Comments=true
  133. Midlakes Graduate Receives ‘First in Family’ Scholarship
    http://midlakes.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=2380&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=9224&PageID=1
  134. Comments (-1)
    http://midlakes.org/../../site/default.aspx?PageType=3&DomainID=4&ModuleInstanceID=2380&ViewID=6446EE88-D30C-497E-9316-3F8874B3E108&RenderLoc=0&FlexDataID=9224&PageID=1&Comments=true
  135. more
    https://www.midlakes.org/site/default.aspx?PageType=14&DomainID=4&PageID=1&ModuleInstanceID=2380&ViewID=c83d46ac-74fe-4857-8c9a-5922a80225e2&IsMoreExpandedView=True
  136. Subscribe to RSS Feed - News & Notes
    https://www.midlakes.org/site/Default.aspx?PageType=4&DomainID=4&ModuleInstanceID=2380&PageID=1
  137. No text
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9236&PageID=1
  138. Simple Steps to Start the New School Year
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9236&PageID=1
  139. Comments (-1)
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9236&PageID=1&Comments=true
  140. No text
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9212&PageID=1
  141. Midlakes Raises $4K for Relay for Life
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9212&PageID=1
  142. Comments (-1)
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9212&PageID=1&Comments=true
  143. No text
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9070&PageID=1
  144. Midlakes Class of 2020 Graduates
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9070&PageID=1
  145. Comments (-1)
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9070&PageID=1&Comments=true
  146. No text
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9071&PageID=1
  147. Midlakes Virtua (Indoor) Graduation Ceremony
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9071&PageID=1
  148. Comments (-1)
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9071&PageID=1&Comments=true
  149. No text
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9055&PageID=1
  150. Midlakes High School Virtual Awards Ceremony
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9055&PageID=1
  151. Comments (-1)
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9055&PageID=1&Comments=true
  152. No text
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9045&PageID=1
  153. Sixth-grade Send-off
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9045&PageID=1
  154. Comments (-1)
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9045&PageID=1&Comments=true
  155. No text
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9058&PageID=1
  156. Midlakes 7 & 8 Grade Awards
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9058&PageID=1
  157. Comments (-1)
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9058&PageID=1&Comments=true
  158. No text
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9041&PageID=1
  159. Midlakes Elementary School Awards
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9041&PageID=1
  160. Comments (-1)
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9041&PageID=1&Comments=true
  161. No text
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9004&PageID=1
  162. Midlakes National Honor Society Induction Ceremony
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9004&PageID=1
  163. Comments (-1)
    http://midlakes.org/../../site/default.aspx?PageType=3&ModuleInstanceID=4647&ViewID=7b97f7ed-8e5e-4120-848f-a8b4987d588f&RenderLoc=0&FlexDataID=9004&PageID=1&Comments=true
  164. more
    https://www.midlakes.org/site/default.aspx?PageType=14&DomainID=4&PageID=1&ModuleInstanceID=4647&ViewID=fa1f7d98-e7bf-458b-a7e2-7d51c266e481&IsMoreExpandedView=True
  165. Subscribe to RSS Feed - District Videos
    https://www.midlakes.org/site/Default.aspx?PageType=4&DomainID=4&ModuleInstanceID=4647&PageID=1
  166. Aquatics Center
    http://midlakes.org/Page/33
  167. Board of Education
    https://www.midlakes.org/domain/13
  168. Calendar
    https://www.midlakes.org/Page/2
  169. DASA
    http://midlakes.org/Page/1129
  170. Employment
    http://midlakes.org/Page/3163
  171. Lunch Menus
    http://midlakes.org/Page/1106
  172. Non-Discrimmination Note
    http://midlakes.org/Page/1100
  173. Parents
    https://www.midlakes.org/domain/12
  174. Sports Schedules
    http://midlakes.org/Page/1133
  175. Staff Directory
    http://midlakes.org/Page/3165
  176. Labor Day
    https://www.midlakes.org/site/Default.aspx?PageID=2&DomainID=4#calendar1/20200907/event/4745
  177. Superintendent's Conference Day
    https://www.midlakes.org/site/Default.aspx?PageID=2&DomainID=4#calendar1/20200908/event/4746
  178. Midlakes PTO Meeting
    https://www.midlakes.org/site/Default.aspx?PageID=2&DomainID=4#calendar1/20200908/event/4752
  179. Superintendent's Conference Day
    https://www.midlakes.org/site/Default.aspx?PageID=2&DomainID=4#calendar1/20200909/event/4747
  180. View Calendar
    http://midlakes.org/Page/2
  181. Accessibility Info
    http://midlakes.org/Page/3197
  182. Employment
    http://midlakes.org/Page/43
  183. Contact Us
    http://midlakes.org/Page/3198
  184. Site Map
    http://midlakes.org/site/Default.aspx?PageType=15&SiteID=4&SectionMax=15&DirectoryType=6

Links - Internal (nofollow)

0:

Links - Outbound

11:
  1. Schoology
    https://midlakes.schoology.com/login/ldap?&school=598487595
  2. Seesaw
    https://app.seesaw.me/#/login
  3. Clever
    https://clever.com/oauth/authorize?response_type=code&state=4504eb4dd28e4cc8ca8a1241bffb5afeddd65b767fd7d00d1e3e08794eb4ebdd&redirect_uri=https%3A%2F%2Fclever.com%2Fin%2Fauth_callback&client_id=4c63c1cf623dce82caac&confirmed=true&channel=clever&district_id=55d631023a34fd01000020ad
  4. Email Link
    http://portal.office.com
  5. Family Services
    https://ocfs.ny.gov/main/cps/
  6. SchoolTool
    https://st.edutech.org/midlakes
  7. Tweets by MidlakesSchools
    https://twitter.com/MidlakesSchools?ref_src=twsrc%5Etfw
  8. 1490 State Route 488 Clifton Springs, NY 14432
    //www.google.com/maps?q=1490 State Route 488 Clifton Springs, NY 14432
  9. Blackboard Web Community Manager Privacy Policy (Updated)
    https://www.blackboard.com/blackboard-web-community-manager-privacy-statement
  10. Terms of Use
    https://help.blackboard.com/Terms_of_Use
  11. No text
    http://www.blackboard.com

Links - Outbound (nofollow)

0:

Keyword Cloud for Midlakes.org

groupyear groupyear groupmonthhomecoming weekswchanneldropdownhide thisremoveclasshover varthischildrenuluiswalertattrid clickpagemoduleinstanceiduidialogoverlayclosemodalvisiblelastclick elsepmi taguluibreadcrumbsmodulecontent miidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunctionthisclick functionread more4getcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid12districttargetviewlength 0 targetviewtaglist litag container 2makeopenpagesubmenuthisparentmodulecontent miidfinduiwidgetdetailfinduiarticleappendnbspuiswalertlengthvar successthisremoveclasshoverflexdataid groupyeartrimsublisthtml sublistattrariahiddenetargetclasslistcontainsdatepickerimagealttextimagealttext photopmi groupyearmidlakes elementary schooldocumentonclickhid miid sidebarlistviewvaltag enablequirksmode0viewidviewtousedatepicker varadded to checktag viewtouse lookssettimeoutfunction modulecontenthonorenablequirksmode0viewidviewtouse container 2statefalse captioncaption familiesgallerytag iftargetview undefineddoesnt bleed throughesctag viewtouseno ifgroupyear groupmonth groupbyuidialogoverlaybasemodalspelling bee0getcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miiduidialogoverlay uiswalertcontent1 midlakesif ekeycode 27pmi116before contentenablequirksmode0viewid viewtouse tagiseditvar pageid 1var renderloc 0check ifyear1 varifhidmiidsidebarlistviewlength 0school districtduringgroupby renderloc0fromrenderloc0enablequirksmode0tag tagsublistattrariahidden999 imageheighttag tagmoduleinstanceidflexdataidexperiencemidlakes theatrevar renderlocmiid pmi flexdataidvar pageidif dialogoverlaywindowlargemodalbodymoderatecontentlength 0pmi5878before contentrenderloc0fromrenderloc0tag tag enablequirksmode0viewidviewtousepmigroupby11else remove focusnationaltheatresignschoolcompetevar failurethroughcontent doesntloadtaggeddatacontainer miid pmiusdialogoverlaywindowlargemodalbodymoderatecontentlength 0thisremoveclasshover varli akeypressfunctionehidetitle false titleclassstudents islinkedparentzindexview targetview hidmiiddetailviewvalloadgroupeddatacontainer miid2 chksidebar functiondivswspecialmodebarvolleyballswalertopen uiswalertlengthspirit weekvar raisedbydatepicker etargetclasslistcontainsdatepickerhidmiiddetailviewval getcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidgroupby targetview tagif ekeycodeimagesrcchksidebar settimeoutfunction modulecontentfunction loaddatacontaineruidialogoverlayclosemodalvisiblelastclickelse ife vargroupyear groupyearelse removeadduidialogoverlaybasemodal uidialogoverlay uiswalertenablequirksmode0viewidviewtousethisclickvar swalertopen uiswalertlengthalertboxid noclickpmi renderloc0fromrenderloc0groupyearphotoshidecaption falsegroupmonth groupby tagphelpsclifton springsalerthonor societyschool hidecaption falseestopimmediatepropagation epreventdefault getimagewidth 960inductionrenderloc0 viewtouseweek islinked truemiidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunctionrenderloc0fromrenderloc0tag tagbodyonkeydownlist view definedswchanneldropdownhidepagemoduleinstanceid pmi flexdataidarchery clubgroupby enablequirksmode0viewidvideolinktext videoisembedded falsefocus etargetblur etargetclasslistremovefocusalertboxid uiswalertattridalertboxid uiswalertattrid clickflexdataid groupyear groupmonththeirbuilder viewoklength0 viewtouse hidnavs activeselectoridelfsettimeoutfunction modulecontent miidsure moderated contenthidetitleread more openlinkinnewwindowimageheightlidatabcsid activeselectoridfunction etargetview container 2flexdataid groupyear groupyearopenlinkinnewwindow falsedialog if dialogoverlaywindowlargemodalbodymoderatecontentlengthifewhichvideolinktextsublistattrariahidden trueattrariaexpandeddocumentonmouseover4 var pageidhidden detail viewchksidebar function loaddatacontainerraisedbydatepicker estopimmediatepropagationmiid pagemoduleinstanceid pmiactiveselectorid aattrtargetclass of 2020doesnt bleeddatepickermaydocumentonmouseoutestopimmediatepropagation epreventdefaultselectschoolulheightlinktextuserregidactivechannelnavtypeaattrtargetremove focus etargetblurlinkurldatepicker var raisedbydatepickerfalse videolinktext videoisembedded1noclick elsephoto18pageidhidmiiddetailviewval getcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miidgroupby tag viewtouseifhidmiidsidebarlistviewlengthlidatabcsidislinked truegroupmonth groupmonthclubthisclick function loadgroupeddatacontainermore openlinkinnewwindow falseulswpgmenutoplevelremoveclassswpgmenuopenaddclassswpgmenuclosedimagealttext imagebuttonproplinkhreflinktext read moretargetviewlength 0noclickhall2 chksidebarepreventdefault closestepsfunction loaddatacontainer miidviewimagewidth 999subakeypressfunctione ifewhich 13imageetargetclasslistcontainsdatepicker if raisedbydatepickerrenderloc 0targetview hidmiiddetailviewval getcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidtruevideolinktext videoisembeddedgroupmonth groupbyfield13 thisclick functionlicollapsibleeachfunctionchevron960 imageheightlocaluidialogoverlaybasemodal uidialogoverlayphoto galleryteam islinked truevar sublist thischildrenulenablequirksmode0viewid0 alertboxid okclickimageheight 500buildermidlakesitsvar domainidphoto gallery openlinkinnewwindowremovebrokenimageslinktext photopageid 1 varsept 14trueattrariaexpanded falsesitenavulheightfunction loadgroupeddatacontainerestopimmediatepropagation epreventdefault checkswalertopen 1 ifalertboxid oklength 0elementary schoolimagewidth 999 imageheighthall of fameeventdateidview varspringsdomainid 4 varvar data varenablequirksmode0viewidviewtouse containerloadgroupeddatacontaineriftargetview undefined targetviewlengthvar datafalse videolinktexthid miidvirtual9miid sidebarlistviewval getcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidfindtabindexfirstfocus 200 documentreadyfunctionelse if ekeycodedocumentreadyfunction checkscriptmoduleviewcheckscriptmustachehealthsidebarlistviewval getcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miidfalse caption studentswindowlocationvar viewtousedata varvar alertboxid uiswalertattridpagenavigationstatecookieokmaxwidthimageheight 666servicepagemoduleinstanceid pmi renderloc0fromrenderloc0groupyearrenderloc0fromrenderloc0groupyearswalertopen uiswalertlength if10communityalertboxid oklengthviewtouse tag tagmodulecontentamericantitle midlakessidebarlistviewval getcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidgroupbyfieldphoto of studentsundefined999 imageheight 666indooruiswalertlength if swalertopen0 modulecontent miidfinduiwidgetdetailfinduiarticleappendnbspdocumentreadyfunction taglisttargetview looksviewtouse ifhidmiidsidebarlistviewlengthcaption midlakesgradersmoremiidmoderated contentiroquoistag iftargetviewuiswalertbleedvarmoderated content doesntpmi groupyear groupmonthsettimeoutfunctionkeybeeescapechksidebarif alertboxid oklengthgroupby targetviewsidebar list viewhidmiiddetailviewvalcontent doesnt bleedlinktext readaattrhrefdialog if200 documentreadyfunction var666 imagealttextshowstudents islinked truepagemoduleinstanceid pmi renderloc0fromrenderloc0tagfalse caption familiesactive classid of openmembersrenderloc0fromrenderloc0enablequirksmode0tag tag viewiduiswalertattrid click okfalse titleif raisedbydatepicker estopimmediatepropagationstartmake sure moderatedsidebarcheck to makeaddedcontainer 2okclick else alertboxidcalendardialog4 varvideoisembedded false videoiframeswalertopen 1renderloc0fromrenderloc0groupyear groupyear groupmonthcontainer 2 chksidebarweek islinkedcallcontrollerfailureresult0errormessageepreventdefault get idflexdataid flexdataidsidebar listepreventdefault check ifimageheight 666 imagealttextbleed throughescape key estopimmediatepropagationgroupby renderloc0fromrenderloc0enablequirksmode0tagrenderloc0fromrenderloc0enablequirksmode0taghighvar swalertopenhidetitle falsefamiliestargetview hidmiiddetailviewvaldata var successokclick elsespiritswgotosearchresultspageswsearchinputdetailmiid pmi2 chksidebar settimeoutfunctionceremonymidlakes theatre experiencethischildrenul if trimsublisthtmlgradeidfocusmidlakes high schoolmidlakes schoolsuiswalertattrid0 var miidfalse title midlakes170 varoklength 0dialogoverlaywindowlargemodalbodymoderatecontentlength3apiview definedalreadypmi renderloc0fromrenderloc0groupyear groupyeartrimsublisthtmlclose dialog uidialogoverlayclosemodalvisiblelastclickhiddenhreffunction loadtaggeddatacontainer miidchanneluiswalert function esectionphelpscliftonmiid sidebarlistviewvalphoto of midlakestag enablequirksmode0viewidviewtouse containerakeypressfunctionepmi5878beforezindexif trimsublisthtmlsublist thischildrenul iffailurechecktag tag containerekeycodeopenlinkinnewwindow false videolinktexthidden sidebarestopimmediatepropagationraisedbydatepicker etargetclasslistcontainsdatepickerfunction loadtaggeddatacontainer750 imageheightiftargetview undefined19nofalse videoiframefocus etargetblurmodulecontent miid findtabindexfirstfocusmake sureviewidalertboxid noclick elsedialogoverlaywindowlargemodalbodymoderatecontentlength 0 modulecontentetargetclasslistcontainsdatepicker ifdialog uidialogoverlayclosemodalvisiblelastclickelse alertboxid noclickviewid targetviewloadtaggeddatacontainercaption midlakes theatrechksidebar function loadtaggeddatacontainerpmi flexdataid flexdataidfunction loadgroupeddatacontainer miidvar viewtouse ifhidmiidsidebarlistviewlengthuidialogoverlay uiswalert function666 imagealttext photonavloaddatacontainer miiddetail view definedif escremoveopenlinkinnewwindowswchanneldropdownhide thisremoveclasshoverloadgroupeddatacontainer miid pmithischildrenul ifteamsiteimagewidth 750 imageheightgroupyear groupmonthseptbodyonkeydown uidialogoverlaybasemodal uidialogoverlaytrueattrariaexpandedcheckscriptmoduleviewcheckscriptmustacherenderloc0fromrenderloc0groupyear groupyear6alert var alertboxidlawncaption students13 thisclickifewhich 13 thisclick1 var renderlocraisedbydatepicker1 if ekeycodemiid findtabindexfirstfocus 200uiswalert functionstaffoklength 0 alertboxidifhidmiidsidebarlistviewlength 0 viewtouselinktext photo gallerytargetview containerwatchhidden sidebar listbuilder view targetviewloadtaggeddatacontainer miidgroupmonth groupbyfield groupbymoderatedelementarygroupmonthfindtabindexfirstfocus 200targetview0 targetview looksclose dialogmore openlinkinnewwindowgroupbyfield groupby enablequirksmode0viewidpageid 1successdocumentreadyfunctionekeycode 27 escapecomments 1documentreadyfunction var domainidhidden detailmiid findtabindexfirstfocus15false caption midlakeshomegraduationgroupbyfield groupbychksidebar settimeoutfunctionlooks1 ifstudentsifewhich 13if alertboxidimagewidth 750targetview tagif eventkeycodeislinked true linkurlpmi renderloc0fromrenderloc0tagthisremoveclasshover var sublisthomecoming16function ifraisedbydatepicker etargetclasslistcontainsdatepicker ifstrcookiepmi flexdataid groupyearallendgetcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid pagemoduleinstanceid13targetviewlengthdata success failuresafetyswinnerwrapheightepreventdefault checktag containerbuilder view varalert varetargetblur etargetclasslistremovefocusmidlakes elementarye var swalertopenesc was pressedviewtouse hid miidcelebratetrimsublisthtml sublistattrariahidden trueattrariaexpandedvideoisembeddedmiidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunction checkscriptmoduleviewcheckscriptmustacheeawardsviewid targetview containerfamesublistelsemiid pmi tagclickakeypressfunctione ifewhichboardartno if alertboxidviewtouse hidif trimsublisthtml sublistattrariahiddenmedia maxwidthgroupby enablequirksmode0viewid viewtousespellingepreventdefault close dialogactiveflexdataid flexdataid groupyearif raisedbydatepickergroupmonth groupbyrenderloc0fromrenderloc0taggallery openlinkinnewwindowcomments 1 midlakesclick okif swalertopenview var viewtouseetargetclasslistremovefocusarcherypagenavigationstatecookie functionspecial14doesntokclickdata successdefined200 documentreadyfunctionswalertopenok or noundefined targetviewlength 0documentreadyfunction taglist livideoiframenavigationsureraisedbydatepicker estopimmediatepropagation epreventdefaultetargetclasslistremovefocus documentreadyfunctionimagewidthveteransfinddomainid 4detail viewopen alert varfunction e varsetseveraletargetblur etargetclasslistremovefocus documentreadyfunctionepreventdefault getmediafirstcaptionfunction5eventkeycodeif swalertopen 1epreventdefaultloaddatacontainermiid pmi groupyearlist viewundefined targetviewlengthviewtouse tagkey estopimmediatepropagation epreventdefaultrenderloc0fromrenderloc0enablequirksmode0tag taggetvideoisembedded falsenoclick else if0 targetview2var miidalertboxid okclick elseuidialogoverlayeventschool hidecaptionactiveselectorid aattrhrefpmpmi renderloc0fromrenderloc0tag tagcloseviewtousetakesuperintendent39sli akeypressfunctione ifewhichelse alertboxidlinksteachersopen alertweekensureviewtouse ifhidmiidsidebarlistviewlength 0groupmonth groupmonth groupbyfieldescape keynew school yearpmi116beforemiidfinduiwidgetdetailfinduiarticleappendnbspschoolsaddoffcanvasmenuheightforsitenavdatauidialogoverlayclosemodalvisiblelastclick else removeiftargetviewcheck if escpmi flexdataidfalse27 escape keypressed on datepickerdaypagemoduleinstanceid pmi7groupmonth groupby targetviewtaglistalertboxid27 escapeislinkednavssublistattrariahidden trueattrariaexpanded falsemiid pagemoduleinstanceidifmidlakes highestopimmediatepropagation epreventdefault closeopenteam islinkedhidhidecaption false captionsublist thischildrenulfindtabindexfirstfocusmidlakes studentsenablequirksmode0viewid viewtouseview targetviewtaglist li akeypressfunctionemodulecontent miidchksidebar functiongroupyear groupmonth groupmonthtargetview tag iftargetviewbreakfastekeycode 27theatre experiencenew schoolactiveselectoridgallery openlinkinnewwindow falserenderloc 0 varthrough the dialoguiswalertlength iftagremove focusvar sublistsure moderatedbodyonkeydown uidialogoverlaybasemodalrightsubmittedheightdomainideducationetargetblurdocumentreadyfunction vardialog uidialogoverlayclosemodalvisiblelastclick elsevar raisedbydatepickertag viewid targetviewsocietygroupbyfield groupby renderloc0fromrenderloc0enablequirksmode0tagpageif dialogoverlaywindowlargemodalbodymoderatecontentlengthcommentsfailure callcontrollerfailureresult0errormessageschool boardfalse videoiframe flexdataidhidecaptiongroupby tagimagewidth 960 imageheightvar domainid 4var failure callcontrollerfailureresult0errormessageget idschool year0 if0 alertboxidtag viewidpmi tag viewtousetitlesignsvar alertboxidreadlialertboxid okclicknewhigh schoolvideoiframe flexdataidtrue linkurlloaddatacontainer miid pmipressed0 modulecontentbackgroupyearcontainer8success failurekey estopimmediatepropagationlistsidebarlistviewvalviewtouse looks

Longtail Keyword Density for Midlakes.org

KeywordsOccurences
hidecaption false caption39
hidetitle false title39
videoisembedded false videoiframe38
islinked true linkurl38
openlinkinnewwindow false videolinktext37
false videoiframe flexdataid36
videolinktext videoisembedded false36
false videolinktext videoisembedded35
linktext photo gallery34
photo gallery openlinkinnewwindow34
imagewidth 999 imageheight32
gallery openlinkinnewwindow false32
if ekeycode 2720
27 escape key20
key estopimmediatepropagation epreventdefault20
ekeycode 27 escape20
escape key estopimmediatepropagation20
container 2 chksidebar18
getcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid pagemoduleinstanceid18
miid pagemoduleinstanceid pmi18
-sidebarlistviewval getcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid12
miid -sidebarlistviewval getcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid12
groupyear groupmonth groupmonth12
2 chksidebar function12
hid- miid -sidebarlistviewval12
999 imageheight 66612
viewtouse hid- miid12
imageheight 666 imagealttext12
groupmonth groupbyfield groupby12
0 viewtouse hid-12
groupmonth groupmonth groupbyfield12
ifhid-miid-sidebarlistviewlength 0 viewtouse12
tag viewtouse looks12
viewtouse ifhid-miid-sidebarlistviewlength 012
var viewtouse ifhid-miid-sidebarlistviewlength12
view var viewtouse12
builder view var12
list view defined12
groupyear groupmonth groupby12
sidebar list view12
hidden sidebar list12
bodyonkeydown ui-dialog-overlay-base-modal ui-dialog-overlay10
ui-dialog-overlay-base-modal ui-dialog-overlay ui-sw-alert10
swalertopen 1 if10
ui-dialog-overlay ui-sw-alert function10
ui-sw-alert function e10
function e var10
e var swalertopen10
swalertopen ui-sw-alertlength if10
ui-sw-alertlength if swalertopen10
if swalertopen 110
var swalertopen ui-sw-alertlength10
1 if ekeycode10
epreventdefault get id10
raisedbydatepicker estopimmediatepropagation epreventdefault10
esc was pressed10
pressed on datepicker10
datepicker var raisedbydatepicker10
var raisedbydatepicker etargetclasslistcontainsdatepicker10
raisedbydatepicker etargetclasslistcontainsdatepicker if10
etargetclasslistcontainsdatepicker if raisedbydatepicker10
if raisedbydatepicker estopimmediatepropagation10
estopimmediatepropagation epreventdefault close10
epreventdefault check if10
epreventdefault close dialog10
close dialog ui-dialog-overlay-closemodalvisiblelastclick10
dialog ui-dialog-overlay-closemodalvisiblelastclick else10
ui-dialog-overlay-closemodalvisiblelastclick else remove10
else remove focus10
remove focus etargetblur10
focus etargetblur etargetclasslistremovefocus10
check if esc10
estopimmediatepropagation epreventdefault check10
id of open10
if alertboxid oklength10
open alert var10
alert var alertboxid10
var alertboxid ui-sw-alertattrid10
alertboxid ui-sw-alertattrid click10
ui-sw-alertattrid click ok10
ok or no10
no if alertboxid10
alertboxid oklength 010
else if ekeycode10
oklength 0 alertboxid10
0 alertboxid okclick10
alertboxid okclick else10
okclick else alertboxid10
else alertboxid noclick10
alertboxid noclick else10
noclick else if10
estopimmediatepropagation epreventdefault get10
etargetblur etargetclasslistremovefocus documentreadyfunction9
photo of midlakes9
false caption midlakes8
midlakes elementary school8
comments -1 midlakes8
666 imagealttext photo7
function loadtaggeddatacontainer miid6
chksidebar function loadtaggeddatacontainer6
targetview container 26
viewid targetview container6
flexdataid flexdataid groupyear6
tag viewid targetview6
miid pmi tag6
renderloc0fromrenderloc0enablequirksmode0tag tag viewid6
groupby renderloc0fromrenderloc0enablequirksmode0tag tag6
groupbyfield groupby renderloc0fromrenderloc0enablequirksmode0tag6
groupyear groupyear groupmonth6
loadtaggeddatacontainer miid pmi6
pmi renderloc0fromrenderloc0tag tag6
pmi tag viewtouse6
pagemoduleinstanceid pmi renderloc0fromrenderloc0tag6
renderloc0fromrenderloc0tag tag enablequirksmode0viewidviewtouse6
tag enablequirksmode0viewidviewtouse container6
enablequirksmode0viewidviewtouse container 26
2 chksidebar settimeoutfunction6
chksidebar settimeoutfunction module-content-6
settimeoutfunction module-content- miid6
module-content- miid findtabindexfirstfocus6
miid findtabindexfirstfocus 2006
midlakes high school6
flexdataid groupyear groupyear6
targetview tag iftargetview6
pmi flexdataid flexdataid6
akeypressfunctione ifewhich 136
dialog-overlay-windowlargemodal-bodymoderatecontentlength 0 module-content-6
0 module-content- miidfindui-widget-detailfindui-articleappendnbsp6
module-content- miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction6
miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction checkscriptmoduleviewcheckscriptmustache6
documentreadyfunction tag-list li6
tag-list li akeypressfunctione6
li akeypressfunctione ifewhich6
ifewhich 13 thisclick6
dialog if dialog-overlay-windowlargemodal-bodymoderatecontentlength6
13 thisclick function6
pagemoduleinstanceid pmi flexdataid6
function loadgroupeddatacontainer miid6
loadgroupeddatacontainer miid pmi6
miid pmi groupyear6
pmi groupyear groupmonth6
groupmonth groupby tag6
if dialog-overlay-windowlargemodal-bodymoderatecontentlength 06
through the dialog6
pagemoduleinstanceid pmi renderloc0fromrenderloc0groupyear6
var renderloc 06
documentreadyfunction var domainid6
var domainid 46
domainid 4 var6
4 var pageid6
var pageid 16
pageid 1 var6
1 var renderloc6
renderloc 0 var6
doesnt bleed through6
0 var miid6
added to check6
check to make6
make sure moderated6
sure moderated content6
moderated content doesnt6
content doesnt bleed6
groupby tag viewtouse6
thisclick function loadgroupeddatacontainer6
function loaddatacontainer miid6
tag iftargetview undefined6
tag container 26
chksidebar function loaddatacontainer6
loaddatacontainer miid pmi6
miid pmi flexdataid6
pmi flexdataid groupyear6
flexdataid groupyear groupmonth6
groupmonth groupby targetview6
groupby targetview tag6
iftargetview undefined targetviewlength6
viewtouse tag tag6
undefined targetviewlength 06
targetviewlength 0 targetview6
0 targetview looks6
hidden detail view6
detail view defined6
builder view targetview6
view targetview hid-miid-detailviewval6
targetview hid-miid-detailviewval getcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid6
tag tag container6
hid-miid-detailviewval getcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid6
pmi renderloc0fromrenderloc0groupyear groupyear6
groupbyfield groupby enablequirksmode0viewid6
enablequirksmode0viewid viewtouse tag6
groupby enablequirksmode0viewid viewtouse6
renderloc0fromrenderloc0groupyear groupyear groupmonth6
trimsublisthtml sublistattraria-hidden trueattraria-expanded5
sublistattraria-hidden trueattraria-expanded false5
false caption students5
if trimsublisthtml sublistattraria-hidden5
class of 20205
var sublist thischildrenul4
sublist thischildrenul if4
imagewidth 750 imageheight4
thischildrenul if trimsublisthtml4
school hidecaption false4
imagewidth 960 imageheight4
200 documentreadyfunction var4
new school year4
more openlinkinnewwindow false4
read more openlinkinnewwindow4
linktext read more4
findtabindexfirstfocus 200 documentreadyfunction4
sw-channel-dropdownhide thisremoveclasshover var3
thisremoveclasshover var sublist3
data success failure3
var failure callcontrollerfailureresult0errormessage3
students islinked true3
data var success3
hall of fame3
false caption families3
false title midlakes3
week islinked true3
team islinked true3
caption midlakes theatre3
midlakes theatre experience3
photo of students3
var data var3
hidetitle false39
false caption39
hidecaption false39
false title39
false videoiframe38
videoisembedded false38
islinked true38
true linkurl38
videoiframe flexdataid37
false videolinktext37
openlinkinnewwindow false37
videolinktext videoisembedded36
photo gallery34
linktext photo34
gallery openlinkinnewwindow34
imagewidth 99932
999 imageheight32
estopimmediatepropagation epreventdefault30
imagealttext photo25
groupyear groupmonth24
if ekeycode23
key estopimmediatepropagation20
escape key20
27 escape20
ekeycode 2720
miid pagemoduleinstanceid18
2 chksidebar18
container 218
miid pmi18
pagemoduleinstanceid pmi18
view defined18
getcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid18
builder view18
comments -113
groupbyfield groupby12
-sidebarlistviewval getcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid12
miid -sidebarlistviewval12
hid- miid12
viewtouse hid-12
flexdataid groupyear12
pmi flexdataid12
0 viewtouse12
ifhid-miid-sidebarlistviewlength 012
groupmonth groupbyfield12
list view12
groupmonth groupmonth12
else if12
imageheight 66612
666 imagealttext12
viewtouse ifhid-miid-sidebarlistviewlength12
groupmonth groupby12
tag viewtouse12
viewtouse looks12
hidden sidebar12
sidebar list12
view var12
chksidebar function12
var viewtouse12
alertboxid okclick10
click ok10
no if10
if alertboxid10
alertboxid oklength10
oklength 010
0 alertboxid10
focus etargetblur10
alertboxid ui-sw-alertattrid10
remove focus10
okclick else10
else remove10
else alertboxid10
ui-dialog-overlay-closemodalvisiblelastclick else10
dialog ui-dialog-overlay-closemodalvisiblelastclick10
close dialog10
ui-sw-alertattrid click10
var alertboxid10
epreventdefault get10
var swalertopen10
etargetblur etargetclasslistremovefocus10
1 if10
swalertopen 110
if swalertopen10
ui-sw-alertlength if10
swalertopen ui-sw-alertlength10
e var10
alert var10
function e10
ui-sw-alert function10
ui-dialog-overlay ui-sw-alert10
ui-dialog-overlay-base-modal ui-dialog-overlay10
bodyonkeydown ui-dialog-overlay-base-modal10
get id10
open alert10
epreventdefault close10
var raisedbydatepicker10
elementary school10
datepicker var10
if esc10
check if10
raisedbydatepicker etargetclasslistcontainsdatepicker10
etargetclasslistcontainsdatepicker if10
if raisedbydatepicker10
raisedbydatepicker estopimmediatepropagation10
epreventdefault check10
alertboxid noclick10
noclick else10
midlakes elementary9
etargetclasslistremovefocus documentreadyfunction9
-1 midlakes8
media max-width8
caption midlakes8
imagealttext image8
high school7
school year7
documentreadyfunction var7
0 var7
miid findtabindexfirstfocus6
loadtaggeddatacontainer miid6
function loadgroupeddatacontainer6
loadgroupeddatacontainer miid6
findtabindexfirstfocus 2006
pmi renderloc0fromrenderloc0tag6
module-content- miid6
renderloc0fromrenderloc0tag tag6
chksidebar settimeoutfunction6
enablequirksmode0viewidviewtouse container6
pmi tag6
tag enablequirksmode0viewidviewtouse6
settimeoutfunction module-content-6
moderated content6
midlakes high6
var sublist6
thisclick function6
13 thisclick6
ifewhich 136
akeypressfunctione ifewhich6
li akeypressfunctione6
targetview container6
tag-list li6
documentreadyfunction tag-list6
dialog-overlay-windowlargemodal-bodymoderatecontentlength 06
0 module-content-6
module-content- miidfindui-widget-detailfindui-articleappendnbsp6
miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction6
documentreadyfunction checkscriptmoduleviewcheckscriptmustache6
sure moderated6
function loadtaggeddatacontainer6
viewid targetview6
var domainid6
tag container6
tag viewid6
viewtouse tag6
enablequirksmode0viewid viewtouse6
groupby enablequirksmode0viewid6
renderloc0fromrenderloc0groupyear groupyear6
pmi renderloc0fromrenderloc0groupyear6
groupby tag6
doesnt bleed6
domainid 46
dialog if6
4 var6
var pageid6
pageid 16
1 var6
content doesnt6
var renderloc6
renderloc 06
var miid6
make sure6
bleed through6
tag tag6
targetview tag6
targetviewlength 06
renderloc0fromrenderloc0enablequirksmode0tag tag6
groupby renderloc0fromrenderloc0enablequirksmode0tag6
groupyear groupyear6
flexdataid flexdataid6
hid-miid-detailviewval getcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid6
targetview hid-miid-detailviewval6
view targetview6
detail view6
hidden detail6
targetview looks6
0 targetview6
undefined targetviewlength6
iftargetview undefined6
if dialog-overlay-windowlargemodal-bodymoderatecontentlength6
pmi groupyear6
function loaddatacontainer6
loaddatacontainer miid6
if trimsublisthtml6
groupby targetview6
tag iftargetview6
trimsublisthtml sublistattraria-hidden5
pmi-116before content5
if eventkeycode5
sublistattraria-hidden trueattraria-expanded5
trueattraria-expanded false5
pmi-5878before content5
caption students5
midlakes students5
function if4
activeselectorid aattrhref4
0 if4
imagewidth 9604
midlakes schools4
960 imageheight4
school hidecaption4
linktext read4
read more4
more openlinkinnewwindow4
new school4
thischildrenul if4
sublist thischildrenul4
200 documentreadyfunction4
imagewidth 7504
750 imageheight4
midlakes theatre4
var failure3
failure callcontrollerfailureresult0errormessage3
data success3
success failure3
active class3
var success3
lidata-bcsid activeselectorid3
navs- activeselectorid3
sw-channel-dropdownhide thisremoveclasshover3
activeselectorid aattrtarget3
thisremoveclasshover var3
pagenavigationstatecookie function3
honor society3
sept 143
phelps-clifton springs3
imageheight 5003
homecoming week3
caption families3
title midlakes3
school district3
data var3
spirit week3
week islinked3
team islinked3
theatre experience3
archery club3
students islinked3
spelling bee3
school board3
var data3
false164
if121
var99
function69
miid60
photo60
midlakes58
057
flexdataid57
true52
imagewidth43
imageheight43
viewtouse42
tag42
alertboxid40
school40
linktext39
openlinkinnewwindow39
videolinktext39
videoisembedded39
videoiframe39
islinked39
hidecaption39
hidetitle39
imagealttext39
imagesrc39
linkurl39
title39
caption39
else39
view38
groupmonth36
pmi36
students36
documentreadyfunction35
gallery34
132
groupyear30
estopimmediatepropagation30
epreventdefault30
groupby24
targetview24
ekeycode23
pagemoduleinstanceid22
221
swalertopen20
raisedbydatepicker20
key20
escape20
chksidebar18
looks18
318
container18
builder18
defined18
hidden18
getcontenthttpswwwmidlakesorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid18
content17
417
check17
dialog16
open16
class14
514
set14
li13
close13
list13
activeselectorid13
comments13
-sidebarlistviewval12
during12
elementary12
612
hid-12
sidebar12
ifhid-miid-sidebarlistviewlength12
no12
module-content-12
remove12
groupbyfield12
click11
documentonclick11
e11
esc11
etargetclasslistremovefocus10
navigation10
ceremony10
ui-dialog-overlay10
undefined10
district10
etargetblur10
ui-dialog-overlay-base-modal10
alert10
oklength10
id10
get10
ui-sw-alertattrid10
ui-sw-alertlength10
okclick10
ui-sw-alert10
noclick10
ok10
pressed10
datepicker10
make10
etargetclasslistcontainsdatepicker10
bodyonkeydown10
ui-dialog-overlay-closemodalvisiblelastclick10
focus10
page9
staff9
week9
79
image9
year9
max-width8
88
through8
new8
media8
graduation7
high7
eventkeycode7
virtual7
data6
day6
renderloc0fromrenderloc0groupyear6
96
failure6
findtabindexfirstfocus6
success6
enablequirksmode0viewid6
settimeoutfunction6
detail6
targetviewlength6
renderloc0fromrenderloc0tag6
loadtaggeddatacontainer6
active6
loaddatacontainer6
viewid6
iftargetview6
renderloc0fromrenderloc0enablequirksmode0tag6
veterans6
hid-miid-detailviewval6
enablequirksmode0viewidviewtouse6
renderloc6
channel6
bleed6
swinnerwrapheight6
sublistattraria-hidden6
trimsublisthtml6
domainid6
sublist6
106
pageid6
116
start6
checkscriptmoduleviewcheckscriptmustache6
miidfindui-widget-detailfindui-articleappendnbsp6
dialog-overlay-windowlargemodal-bodymoderatecontentlength6
families6
thisclick6
sure6
href6
doesnt6
moderated6
added6
tag-list6
loadgroupeddatacontainer6
akeypressfunctione6
ifewhich6
club5
sw-channel-dropdownhide5
art5
springs5
bee5
moduleinstanceid5
awards5
trueattraria-expanded5
community5
pmi-5878before5
isedit5
board5
userregid5
pmi-116before5
124
schools4
windowlocation4
calendar4
hall4
documentonmouseover4
theatre4
find4
national4
documentonmouseout4
graders4
show4
event4
thischildrenul4
aattrhref4
navs-4
home4
134
all4
watch4
pagenavigationstatecookie4
section4
society4
sub4
photos4
special4
more4
144
thisremoveclasshover4
several4
volleyball4
read4
spirit4
licollapsibleeachfunction3
selectschoolulheight3
divsw-special-mode-bar3
lidata-bcsid3
aattrtarget3
activechannelnavtype3
strcookie3
ului-breadcrumbs3
ulsw-pgmenu-toplevelremoveclasssw-pgmenu-openaddclasssw-pgmenu-closed3
nav3
eventdateid3
end3
openpagesubmenuthisparent3
sitenavulheight3
addoffcanvasmenuheightforsitenav3
chevron3
height3
first3
us3
signs3
153
superintendent39s3
compete3
sign3
swgotosearchresultspageswsearchinput3
site3
add3
already3
buttonproplinkhref3
submitted3
parentzindex3
safety3
callcontrollerfailureresult0errormessage3
health3
ensure3
may3
steps3
zindex3
163
sept3
right3
phelps-clifton3
back3
links3
173
183
indoor3
removebrokenimages3
spelling3
grade3
honor3
homecoming3
members3
breakfast3
pm3
american3
induction3
state3
fame3
service3
their3
lawn3
take3
iroquois3
193
celebrate3
archery3
its3
experience3
elf3
team3
education3
local3
teachers3
api3

Midlakes.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Midlakes.org is a scam?

Websites with Similar Names

Midlabs.com
MID Labs - Vitreoretinal Ophthalmic Medical Devices
Midlabschina.com
仪诺康科技(天津)有限公司
Midlake.net
Home | midlake
Midlakebuilders.com
Custom Home Building Since 1987 - Midlake Builders
Midlakecavaliers.com
New York Cavalier King Charles Spaniel Breeder - Cavalier King Charles Spaniels - Mid Lake Cavaliers
Midlakemotors.com
Used Cars Fruitland Park FL | Used Cars & Trucks FL | Midlake Motors
Midlakephotography.com
Midlake Photography
Midlakes.org
Midlakes Schools / Screaming Eagles Homepage

Recently Updated Websites

Cumexposed.com 2 seconds ago.Clarksdale-ms.com 2 seconds ago.Viveurope.nl 2 seconds ago.Bargenbrown.com 5 seconds ago.Wvdayfestival.com 5 seconds ago.Robetting.com 5 seconds ago.Eurozone-centr.ru 5 seconds ago.Tezet.nl 6 seconds ago.Caoliu.biz 6 seconds ago.Carstenschmitz.com 6 seconds ago.Theperfectplaygroundny.com 6 seconds ago.Theadullam.org 6 seconds ago.Ridetoliveutah.org 6 seconds ago.Renttransportation.com 7 seconds ago.Sapan.is 7 seconds ago.Oldmans.org 7 seconds ago.Frameentered.com 7 seconds ago.Barbarahowe.com 7 seconds ago.Cinema6theatre.com 7 seconds ago.Tabletoppoets.com 8 seconds ago.Moveon.info 8 seconds ago.Varp.net 8 seconds ago.Golficeland.org 9 seconds ago.Clarksite.com 9 seconds ago.Kampusqq.com 10 seconds ago.Blissarabians.com 10 seconds ago.Dragoneternity.com 10 seconds ago.Planetarium-moscow.ru 10 seconds ago.Patricktenore.com 11 seconds ago.Lpafilmfestival.com 11 seconds ago.