Migrationsverket.se  |  Privatpersoner - Migrationsverket
Low trust score  | 
Migrationsverket ansvarar för migrationen till Sverige. Det innebär dels att vi hjälper människor som söker skydd och asyl, dels att vi handlägger ansökan om visum eller uppehållstillstånd för människor som vill komma till Sverige på besök, för att arbeta, studera eller återförenas med sin familj. Migrationsverket är också den ...




Migrationsverket.se Website Information

Website Ranks & Scores for Migrationsverket.se

Statvoo Rank Statvoo Rank:D
Alexa Rank Alexa Rank:23,118
Majestic Rank Majestic Rank:39,629
Domain Authority Domain Authority:69%
DMOZ DMOZ Listing:No

Domain Information for Migrationsverket.se

Domain Registrar: NIC-SE
Registration Date:2000-06-08  1 decade 8 years 9 months ago
Expiration Date:2017-12-31  1 year 2 months 2 weeks ago

Whois information for migrationsverket.se

Full Whois Lookup for Migrationsverket.se Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Migrationsverket.se. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

# Copyright (c) 1997- IIS (The Internet Foundation In Sweden).
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: migrationsverket.se
holder: migrat0808-00001
admin-c: migrat0808-00002
admin-c: migrat0808-00003
admin-c: migrat1702-00001
tech-c: telias0702-00012
tech-c: migrat0808-00002
tech-c: migrat0808-00003
tech-c: migrat1008-00001
tech-c: migrat1012-00001
billing-c: migrat0912-00001
created: 2000-06-08
modified: 2017-02-06
expires: 2017-12-31
nserver: ns1.migrationsverket.se 192.176.66.68 2001:67c:18d8:2::4
nserver: ns2.migrationsverket.se 192.176.66.76 2001:67c:18d8:3::4
dnssec: signed delegation
status: ok
registrar: SE Direkt

Who hosts Migrationsverket.se?

Migrationsverket.se is hosted by Migrationsverket in Stockholms Lan, Taby, Sweden, 18780.
Migrationsverket.se has an IP Address of 192.176.65.45 and a hostname of www.migrationsverket.se and runs Apache-Coyote/1.1 web server.



Migrationsverket.se Web Server Information

Hosted IP Address:192.176.65.45
Hosted Hostname:www.migrationsverket.se
Service Provider:Migrationsverket
Hosted Country:SwedenSE
Location Latitude:59.4439
Location Longitude:18.0687
Webserver Software:Apache-Coyote/1.1

HTTP Header Analysis for Migrationsverket.se

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 19 Jun 2015 05:10:53 GMT
Server: Apache-Coyote/1.1
X-UA-Compatible: IE=EDGE
Cache-Control: no-cache
Pragma: no-cache
Expires: Tue, 01 Jan 1980 12:01:01 GMT
Content-Type: text/html;charset=UTF-8
Content-Encoding: gzip
Vary: Accept-Encoding
Connection: close
Transfer-Encoding: chunked


Need to find out who hosts Migrationsverket.se?

Migrationsverket.se Free SEO Report

Website Inpage Analysis for Migrationsverket.se

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Migrationsverket.se

maxwidthfr digflyttacharttypesvenskttillstnd frnyheterochsvjqemwrappercssdisplayyfrasylngondin anskanuppdragnull5pxblockduomsom villtrueseminariervarenableddiggymnasielagensvenskt medborgarskapmigrationsverketsosstillstnd fr attsverigeuppehllstillstnd37pxfrnelsetillstndbeskdenharsomattenglish1autoflytta tillmedborgarskapifstuderapaddingpbeskaboka tidskapersonerngon i sverigekanelse if 10meddetif 10leftarbeta0tidanskanfalsedinskyddtillvrnamekakorbokaelse ifavsvjqemwrappercssdisplay blockvillfrgor0pxrmigrationsverketfr att

Longtail Keyword Density for Migrationsverket.se

KeywordsOccurences
tillstnd fr att6
else if 104
ngon i sverige3
fr att10
tillstnd fr6
if 105
svjqem-wrappercssdisplay block4
else if4
din anskan3
boka tid3
som vill3
fr dig3
flytta till3
svenskt medborgarskap3
och19
att17
sverige17
fr15
till15
om13
p13
migrationsverket11
som10
oss9
tillstnd8
frn8
true8
r7
med7
else7
name6
block6
uppehllstillstnd6
uppdrag5
tid5
personer5
av5
false5
05
y5
if5
det4
svjqem-wrappercssdisplay4
nyheter4
var4
auto4
dig4
du4
kan4
ska4
beska4
boka3
din3
migrationsverkets3
null3
vr3
37px3
enabled3
gymnasielagen3
charttype3
seminarier3
anskan3
ngon3
padding3
5px3
english3
vill3
left3
0px3
kakor3
13
max-width3
flytta3
arbeta3
besk3
svenskt3
medborgarskap3
den3
har3
skydd3
asyl3
studera3
frgor3

What are the nameservers for migrationsverket.se?

Migrationsverket.se Domain Nameserver Information

HostIP AddressCountry
ns.migrationsverket.se 192.176.65.41Sweden Sweden
ns2.migrationsverket.se 192.176.65.61Sweden Sweden

Migrationsverket.se Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Migrationsverket.se is a scam?