Inicio MH - Alcaldía Miguel Hidalgo

Safety: Low trust score
Year Founded: 2001
Global Traffic Rank: Unknown
Estimated Worth: $89,400
Category: News and Media

Alcaldía Miguel Hidalgo, El Corazón de la Capital. Parque Lira No. 94, Col. Observatorio CP 11860 Ciudad de México, Línea Directa del Alcalde: 55 3408 8236



Domain summary

Last updated
2020-06-02
Domain label
miguelhidalgo
Domain extension
gob.mx
Domain registered:
2001-01-22
Domain updated:
2015-02-07
Domain expires:
2016-01-21
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$89,400
Estimated daily income
$149
Estimated monthly income
$4,532

Frequently Asked Questions (FAQ)

Q: When was Miguelhidalgo.gob.mx registered?
A: Miguelhidalgo.gob.mx was registered 20 years, 7 months, 4 weeks, 2 days, 20 hours, 53 minutes, 41 seconds ago on Monday, January 22, 2001.
Q: When was the WHOIS for Miguelhidalgo.gob.mx last updated?
A: The WHOIS entry was last updated 6 years, 7 months, 2 weeks, 20 hours, 53 minutes, 41 seconds ago on Saturday, February 7, 2015.
Q: Who is the registrar for the Miguelhidalgo.gob.mx domain?
A: The domain has been registered at NIC Mexico.
Q: What is the traffic rank for Miguelhidalgo.gob.mx?
A: Miguelhidalgo.gob.mx has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Miguelhidalgo.gob.mx each day?
A: Miguelhidalgo.gob.mx receives approximately 11,939 visitors and 59,695 page impressions per day.
Q: What IP address does Miguelhidalgo.gob.mx resolve to?
A: Miguelhidalgo.gob.mx resolves to the IPv4 address 201.116.31.229.
Q: In what country are Miguelhidalgo.gob.mx servers located in?
A: Miguelhidalgo.gob.mx has servers located in the Mexico.
Q: What webserver software does Miguelhidalgo.gob.mx use?
A: Miguelhidalgo.gob.mx is powered by webserver.
Q: Who hosts Miguelhidalgo.gob.mx?
A: Miguelhidalgo.gob.mx is hosted by Uninet S.A. de C.V. in Distrito Federal, Venustiano Carranza, Mexico, 15340.
Q: How much is Miguelhidalgo.gob.mx worth?
A: Miguelhidalgo.gob.mx has an estimated worth of $89,400. An average daily income of approximately $149, which is roughly $4,532 per month.

Miguelhidalgo.gob.mx Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Miguelhidalgo.gob.mx Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Miguelhidalgo.gob.mx

H1 Headings

1 :
  1. 1

H2 Headings

1 :
  1. 1

H3 Headings

1 :
  1. 1

H4 Headings

1 :
  1. 27

H5 Headings

1 :
  1. 0

H6 Headings

1 :
  1. 0

Total IFRAMEs

1 :

Total Images

29 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-39932759-1

Links - Internal

1:

Links - Internal (nofollow)

1:

Links - Outbound

1:

Links - Outbound (nofollow)

1:

Keyword Cloud for Miguelhidalgo.gob.mx

displaywdifeeditemmarginwdifeed0 wdifeeditem widthtrmitesguerraserviciosconcejales100 marginalcaldavctor hugobackgroundcolor fffffftinacos mh100 margin 0abrilinlineblock verticalalignoverflow hidden wdifeed0wdifeeditem widthverticalalign top overflowwidth 100 margindelboletn de prensatinacos0 autoverticalalignvctorpadrn de tercerospasaportes2operacindanielboletin de prensalineamientos3apoyoromo de vivarhidden wdifeed0 wdifeedcontainerwdifeed0 wdifeeditemterceros acreditadosinlineblock verticalalign topinlineblocktopwdifeedcontainerpadrnalcaldepdfboletinfechawdifeed04top overflowffffffhidden wdifeed0wdifeedcontainer width 100screenthumbnailsize margin 0auto backgroundcolorthumbnailsize marginauto backgroundcolor ffffffconvocatoriaviviendamaxwidthwdifeedcontainer widthpor0 display inlineblockleerromoydisplay inlineblock verticalalignvivarparavctor hugo romoventanilla0 auto backgroundcolorgarzacoloniamargin 0overflow hiddenbackgroundcolormiguelacreditadosmiguel hidalgowdifeed0 wdifeedcontainerhidden0 displayleer msnoticiasbackgroundcolor ffffff feedcontainerbgcolordaniel garzaboletn51width 100hugo romowidthfeedcontainerbgcoloroverflowmediamargin 0 displaylastop overflow hiddencesacventanilla nicamhmargin 0 auto0nicamedia screenhidalgoautohugothumbnailsizeloswdifeed0 wdifeedcontainer widthinformacinmstercerostinacos mh pdfvivar guerraffffff feedcontainerbgcolorverticalalign topmh pdfdisplay inlineblockprensa

Longtail Keyword Density for Miguelhidalgo.gob.mx

KeywordsOccurences
wdifeed0 wdifeeditem width4
tinacos mh pdf4
top overflow hidden3
auto background-color ffffff3
0 auto background-color3
margin 0 auto3
100 margin 03
width 100 margin3
wdifeedcontainer width 1003
wdifeed0 wdifeedcontainer width3
hidden wdifeed0 wdifeedcontainer3
overflow hidden wdifeed03
vertical-align top overflow3
boletin de prensa3
inline-block vertical-align top3
display inline-block vertical-align3
0 display inline-block3
margin 0 display3
thumbnailsize margin 03
padrn de terceros3
romo de vivar3
vctor hugo romo3
boletn de prensa3
background-color ffffff feedcontainerbgcolor3
margin 06
tinacos mh4
wdifeed0 wdifeeditem4
mh pdf4
width 1004
miguel hidalgo4
wdifeeditem width4
overflow hidden3
hidden wdifeed03
wdifeedcontainer width3
wdifeed0 wdifeedcontainer3
vertical-align top3
100 margin3
0 auto3
auto background-color3
background-color ffffff3
top overflow3
0 display3
inline-block vertical-align3
display inline-block3
thumbnailsize margin3
media screen3
terceros acreditados3
leer ms3
vivar guerra3
hugo romo3
vctor hugo3
ventanilla nica3
daniel garza3
ffffff feedcontainerbgcolor3
pdf14
para12
wdifeed011
mh9
09
alcalda8
prensa8
width7
colonia6
margin6
ms6
16
lineamientos6
convocatoria5
display5
trmites5
servicios4
24
operacin4
hidalgo4
miguel4
34
wdifeeditem4
romo4
tinacos4
thumbnailsize4
padrn4
y4
del4
por4
concejales4
vivienda4
44
wdifeedcontainer3
ffffff3
background-color3
auto3
hidden3
acreditados3
overflow3
media3
screen3
max-width3
top3
vertical-align3
inline-block3
fecha3
alcalde3
terceros3
pasaportes3
los3
apoyo3
las3
daniel3
garza3
cesac3
ventanilla3
nica3
noticias3
informacin3
boletin3
boletn3
abril3
53
vctor3
hugo3
vivar3
guerra3
leer3
feedcontainerbgcolor3

Who hosts Miguelhidalgo.gob.mx?

Miguelhidalgo.gob.mx Hosting Provider Information

Hosted IP Address:201.116.31.229
Hosted Hostname:mail.miguelhidalgo.gob.mx
Service Provider:Uninet S.A. de C.V.
Hosted Country:MexicoMX
Location Latitude:19.43
Location Longitude:-99.0992
Webserver Software:Not Applicable

Is "Uninet S.A. de C.V." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
Uninet S.A. de C.V.
0.0031%

HTTP Header Analysis for Miguelhidalgo.gob.mx

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Tue, 02 Jun 2020 03:03:04 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Keep-Alive: timeout=20
Vary: Accept-Encoding
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Link:; rel=shortlink
X-LW-Cache: STALE
Content-Encoding: gzip

Miguelhidalgo.gob.mx Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Miguelhidalgo.gob.mx?


Domain Registration (WhoIs) information for Miguelhidalgo.gob.mx

Websites with Similar Names

Miguealmela.com
Aparecer en Google - Sabemos lo que necesitas para ganar
Migueatelier.com
Migue Atelier
Miguebelleza.com
Welcome miguebelleza.com - BlueHost.com
Miguebo.com
Bienvenidas a MiGuebo.com | Replica Exacta de.... Mi Guebo
Miguecarrillo.com
Milciades soto & compañia sas
Miguecarrillox.com
MIGUE_CARRILLOX – CREA LA MEJOR VERSION DE TI
Miguecmabe.com
miguecmabe.com - Registered at Namecheap.com

Recently Updated Websites

Kokbet7972.com (2 seconds ago.)Thebusinesslocator.net (8 seconds ago.)Zipyroo.com (10 seconds ago.)Chicagobleacherrentals.com (12 seconds ago.)Luminenca.be (12 seconds ago.)Dengine.ca (12 seconds ago.)Realboys.su (13 seconds ago.)Sunoutworkout.com (15 seconds ago.)Bme24.eu (17 seconds ago.)Ents.live (18 seconds ago.)Harrysrooftopgrill.com (19 seconds ago.)Gaiadrill.gr (20 seconds ago.)Thekeypartynyc.com (20 seconds ago.)Dynamics.realty (21 seconds ago.)Belkirustykalne.pl (21 seconds ago.)Angelamelini.com (21 seconds ago.)Socialslang.info (24 seconds ago.)Lafemmevitalerealtor.com (26 seconds ago.)Abideandabound.com (28 seconds ago.)Rdn-consult.online (28 seconds ago.)Howtogetintoyachting.com (31 seconds ago.)Rapidresponserestorationwtn.com (31 seconds ago.)Ftcollinshomeinspections.com (32 seconds ago.)Textpleasure.com (33 seconds ago.)Nagoya-nenkin.com (33 seconds ago.)Cluelessexpat.com (33 seconds ago.)Global-tem.com (35 seconds ago.)Americanhoperesources.com (35 seconds ago.)Nootherway.xyz (36 seconds ago.)Hairsalon-apple.com (36 seconds ago.)

Recently Searched Keywords

range 1 11 (2 seconds ago.)путешествие элейны  (4 seconds ago.)江西理达集团有限公司民营|20-99人 (6 seconds ago.)65 25 (6 seconds ago.)literary arts (7 seconds ago.)начало работы с хостингом (7 seconds ago.)pomeranian for sale (10 seconds ago.)μαχαίρια ξεκοκαλίσματος (10 seconds ago.)food network recipes (11 seconds ago.)tryck (11 seconds ago.)producthandle boldtempproducthandle price (12 seconds ago.)zwischen (17 seconds ago.)invisible mannequin (20 seconds ago.)from pats pulpit (26 seconds ago.)servicestour guide (27 seconds ago.)telema (27 seconds ago.)httpsamznto2ww0dgt (31 seconds ago.)mawebtechnologies (33 seconds ago.)2020年冬博会发布会在京召开+推动冰雪经济与服务贸易融合发展 (39 seconds ago.)babycenter due date calculator (41 seconds ago.)mechanical parts (42 seconds ago.)bị tố “lừa đảo” – bạn có thật sự hiểu về mô hình nghỉ dưỡng mới đến từ resorts international việt nam (42 seconds ago.)river tamar (45 seconds ago.)uzbekistan (45 seconds ago.)time saturday october (47 seconds ago.)official website (48 seconds ago.)paru-paru (49 seconds ago.)婚禮主持人 (50 seconds ago.)osa (50 seconds ago.)communauté (50 seconds ago.)