Military and Veterans Benefits Insider's Guide

Safety: Low trust score
Year Founded: 2011
Global Traffic Rank: 48,236
Estimated Worth: $315,360

Military Benefits insider’s guide for Veterans, Active Duty Military, Reserve, National Guard, Military Spouses and families. Discover the many benefits today!



Domain summary

Last updated
2021-08-11
Domain label
militarybenefits
Domain extension
info
Domain registered:
2011-11-27
Domain updated:
2021-08-11
Global Traffic Rank
48,236
Statvoo Rating
D
Trust Score
Low Trust Score
Estimated worth
$315,360
Estimated daily income
$438
Estimated monthly income
$13,323

Frequently Asked Questions (FAQ)

Q: When was Militarybenefits.info registered?
A: Militarybenefits.info was registered 9 years, 9 months, 3 weeks, 1 day, 5 hours, 57 minutes, 2 seconds ago on Sunday, November 27, 2011.
Q: When was the WHOIS for Militarybenefits.info last updated?
A: The WHOIS entry was last updated 1 month, 1 week, 1 day, 5 hours, 57 minutes, 2 seconds ago on Wednesday, August 11, 2021.
Q: What are Militarybenefits.info's nameservers?
A: DNS for Militarybenefits.info is provided by the following nameservers:
  • gina.ns.cloudflare.com
  • ben.ns.cloudflare.com
Q: Who is the registrar for the Militarybenefits.info domain?
A: The domain has been registered at Afilias Global Registry Services.
Q: What is the traffic rank for Militarybenefits.info?
A: Militarybenefits.info ranks 48,236 globally on Alexa. Militarybenefits.info has a Low Trust Score, and a Statvoo Rank of D.
Q: How many people visit Militarybenefits.info each day?
A: Militarybenefits.info receives approximately 36,487 visitors and 218,922 page impressions per day.
Q: What IP address does Militarybenefits.info resolve to?
A: Militarybenefits.info resolves to the IPv4 address 104.26.12.39.
Q: In what country are Militarybenefits.info servers located in?
A: Militarybenefits.info has servers located in the United States.
Q: What webserver software does Militarybenefits.info use?
A: Militarybenefits.info is powered by CloudFlare webserver.
Q: Who hosts Militarybenefits.info?
A: Militarybenefits.info is hosted by TOT Public Company Limited in United States.
Q: How much is Militarybenefits.info worth?
A: Militarybenefits.info has an estimated worth of $315,360. An average daily income of approximately $438, which is roughly $13,323 per month.

Militarybenefits.info Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Militarybenefits.info Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Militarybenefits.info

H1 Headings

1 :
  1. Military Benefits

H2 Headings

11 :
  1. 2022 Military Pay Charts (proposed)
  2. 2022 Defense Budget
  3. COLA Increase Watch 2022
  4. 2021 VA Disability Rates
  5. 2021 Military Pay Charts
  6. 2021 VA Loan Limits by County
  7. Tips For Veterans To Land A Federal Job
  8. Should You Pay Off Your Mortgage Early?
  9. Owning vs Renting
  10. Post 9/11 GI Bill BAH Rate for Online Colleges
  11. Why Choose A VA Loan Instead Of A Regular Mortgage?

H3 Headings

0 :

H4 Headings

9 :
  1. Recent Articles
  2. Popular Articles
  3. Connect With Us
  4. Calculators
  5. Dates To Know
  6. Resources
  7. Company
  8. Join Our Military Benefits Newsletter!
  9. Connect With Us

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

2 :

Total Images

14 :

Google Adsense

:
pub-1380363892231884

Google Analytics

:
Not Applicable

Links - Internal

105:

Links - Internal (nofollow)

0:

Keyword Cloud for Militarybenefits.info

vamilitary pay calculatorchartsratesx02026 read more2021gformwrappergfresetwrapper olbodyveterans benefitsloannotcolax02026 readbaseddepartmentdiscountpbodylibody gformwrappergfresetwrapper olbodycalculator va loan0calculatorbahdisability ratesx02026informationpaydiscountsfriendlylibodymilitary spousepay chartsva loan calculator2022 military payolbody gformwrappergfresetwrapperva disability ratesnationalveteransgetgformwrappergfresetwrapper olbody gformwrappergfresetwrapperva disabilityusemayspouseusgformwrappergfresetwrapper fieldsetbodymilitarydatesdivbody gformwrappergfresetwrapperguidefriendly collegesbillgformwrappergfresetwrapper pbody gformwrappergfresetwrapperfieldsetbody gformwrappergfresetwrapperdivbodygformwrappergfresetwrapperveteran friendlyveteran2022 militarypbody gformwrappergfresetwrappermore2021defenseemploymentmilitary paycollegespay calculatoryouaffairs1calculator militarypay datesgi billidlimitsloan calculatorgovernmentgifieldsetbodystatehomeolbodygformwrappergfresetwrapper libodygformwrappergfresetwrapper divbodyva loanreadgformwrappergfresetwrapper pbodyincreaseloan limitscalculator vadisabilitylibody gformwrappergfresetwrappergformwrappergfresetwrapper divbody gformwrappergfresetwrappergformwrappergfresetwrapper fieldsetbody gformwrappergfresetwrappermilitary pay chartsbenefitsgformwrappergfresetwrapper libody gformwrappergfresetwrapperread more2021038

Longtail Keyword Density for Militarybenefits.info

KeywordsOccurences
2022 military pay5
military pay charts5
military pay calculator4
va loan calculator3
calculator va loan3
va disability rates3
x02026 read more20213
gformwrappergfresetwrapper divbody gformwrappergfresetwrapper3
gformwrappergfresetwrapper fieldsetbody gformwrappergfresetwrapper3
gformwrappergfresetwrapper libody gformwrappergfresetwrapper3
libody gformwrappergfresetwrapper olbody3
gformwrappergfresetwrapper olbody gformwrappergfresetwrapper3
gformwrappergfresetwrapper pbody gformwrappergfresetwrapper3
military pay17
va loan7
x02026 read6
gi bill6
va disability5
2022 military5
pay charts5
veterans benefits4
pay dates4
pay calculator4
calculator va4
gformwrappergfresetwrapper olbody3
divbody gformwrappergfresetwrapper3
olbody gformwrappergfresetwrapper3
libody gformwrappergfresetwrapper3
gformwrappergfresetwrapper libody3
fieldsetbody gformwrappergfresetwrapper3
gformwrappergfresetwrapper pbody3
gformwrappergfresetwrapper fieldsetbody3
veteran friendly3
gformwrappergfresetwrapper divbody3
read more20213
friendly colleges3
military spouse3
disability rates3
calculator military3
loan limits3
loan calculator3
pbody gformwrappergfresetwrapper3
gformwrappergfresetwrapper80
military41
pay22
va17
benefits14
veterans13
loan11
calculator10
us10
010
19
veteran8
defense8
bill6
information6
disability6
gi6
not6
x020266
read6
increase5
rates5
charts5
0385
dates5
discounts5
friendly5
id4
home4
colleges4
bah4
spouse4
affairs4
get3
discount3
department3
government3
pbody3
olbody3
libody3
fieldsetbody3
divbody3
more20213
state3
you3
employment3
cola3
use3
based3
national3
limits3
guide3
may3

Who hosts Militarybenefits.info?

Militarybenefits.info Hosting Provider Information

Hosted IP Address:104.26.12.39
Hosted Hostname:104.26.12.39
Service Provider:TOT Public Company Limited
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "TOT Public Company Limited" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%
TOT Public Company Limited
0.7728%

HTTP Header Analysis for Militarybenefits.info

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 11 Aug 2021 08:55:14 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
cf-edge-cache: cache,platform=wordpress
Link:; rel="https://api.w.org/"
X-Cache-Status: HIT
X-Frame-Options: SAMEORIGIN
X-XSS-Protection: 1; mode=block
X-Content-Type-Options: nosniff
CF-Cache-Status: DYNAMIC
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report\/v3?s=UUJea3xXRwcEaBV+W/AcfERIFs9kGglV3JBkyhKQttwKNqqBa350nRfIRLn+fkFk41dI6M48dt038fcsrUMUkaaMWZqtjj3s6RdxaO4puc/I7e3/IOV5fFS947vbu+eHKl+qqY/u3Q=="}],"group":"cf-nel","max_age":604800}
NEL: {"success_fraction":0,"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 67d03e65cd2f4066-LHR
Content-Encoding: gzip
alt-svc: h3-27=":443"; ma=86400, h3-28=":443"; ma=86400, h3-29=":443"; ma=86400, h3=":443"; ma=86400

Militarybenefits.info Domain Nameserver Information

HostIP AddressCountry
gina.ns.cloudflare.com 173.245.58.117
ben.ns.cloudflare.com 172.64.33.103


Need to find out who hosts Militarybenefits.info?


Domain Registration (WhoIs) information for Militarybenefits.info

 Domain Name: MILITARYBENEFITS.INFO
Registry Domain ID: D44271005-LRMS
Registrar WHOIS Server: whois.moniker.com
Registrar URL: http://www.moniker.com
Updated Date: 2020-05-13T16:42:11Z
Creation Date: 2011-11-27T23:28:15Z
Registry Expiry Date: 2028-11-27T23:28:15Z
Registrar Registration Expiration Date:
Registrar: Moniker Online Services LLC
Registrar IANA ID: 228
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +49.68949396850
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Moniker Privacy Services
Registrant State/Province: OR
Registrant Country: US
Name Server: GINA.NS.CLOUDFLARE.COM
Name Server: BEN.NS.CLOUDFLARE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2021-06-09T10:26:06Z

Websites with Similar Names

Milit.by
Страйкбольная барахолка Беларуси - Milit.by
Milit.it
MILIT.it
Milit.ru
Military Weapons
Milita.click
403 Error - Forbidden
Milita.win
&G??????????? ?????

Recently Updated Websites

Asprojltd.info (2 seconds ago.)Fabdesigns2.com (5 seconds ago.)Gruzchikov-service.ru (9 seconds ago.)Success-international.com (9 seconds ago.)Dmanalytics2.com (9 seconds ago.)Tkdmke.com (12 seconds ago.)Jerseydragons.com (12 seconds ago.)Conalcri.ro (12 seconds ago.)Dfwhomevaluation.com (13 seconds ago.)Covkure.com (14 seconds ago.)Ceararentacar.com.br (17 seconds ago.)Humanitific.com (18 seconds ago.)Boyouenterprise.com (19 seconds ago.)Animalhospitalatgrayhawk.com (19 seconds ago.)Jigsawproptech.com (20 seconds ago.)Daniellefish.com (21 seconds ago.)Vatracs.com (21 seconds ago.)Vynuva-shop.org (23 seconds ago.)Moldallergytreatment.site (23 seconds ago.)Local-magazine.fr (23 seconds ago.)Sheraton.media (24 seconds ago.)Rumptstad.com (25 seconds ago.)Everyoneconnection.info (25 seconds ago.)Thetravelchick.net (25 seconds ago.)Trauerleinwand.com (26 seconds ago.)Lapuenterealestate.life (26 seconds ago.)Cmpdata.com (26 seconds ago.)Mmtq.org (27 seconds ago.)Tianbo678.app (27 seconds ago.)Circleoffriendselc.org (28 seconds ago.)

Recently Searched Keywords

stains (1 second ago.)new zealand map (2 seconds ago.)ipucu: marketten aldığım eti, derin dondurucumda nasıl saklarım (2 seconds ago.)onestep1989 (3 seconds ago.)suudlemine (3 seconds ago.)statement (4 seconds ago.)huohu6135 (5 seconds ago.)valmiera (5 seconds ago.)sobre papel n60 (6 seconds ago.)importantbackground-repeat no-repeat importantbackground-size (6 seconds ago.)my cart$0.00 (7 seconds ago.)ip vpn (7 seconds ago.)musle (8 seconds ago.)315g 37900 (8 seconds ago.)bisnis online (8 seconds ago.)鋁合金麵板線槽 (9 seconds ago.)神经 (10 seconds ago.)communicators (10 seconds ago.)using (10 seconds ago.)about life jacket loaner (10 seconds ago.)d-none (12 seconds ago.)kosher india travel (13 seconds ago.)promo-large-ctahover color (15 seconds ago.)安全动态 (15 seconds ago.)video-0one (16 seconds ago.)cigars daily (16 seconds ago.)sometimes i get (16 seconds ago.)subzeea (17 seconds ago.)stock kraft (17 seconds ago.)onfocusout false (18 seconds ago.)