Minack.info Favicon Minack.info

Minack.info Website Thumbnail
Checking...
Home
Low trust score
Add a review Change category Claim this site
The Minack Chronicles is a series of book collection by Derek Tangye and Jeannie Tangye about their life in Cornwall with their cats, donkeys, the wildlife, flora and fauna and flowers. It is near the South West Coast path and tourist and visitors can visit the nature reserve called Oliver land which is managed by the Cornwall Wildlife Trust.


Domain summary

Domain label
minack
Domain extension
info
Domain registered:
2012-08-18
Domain updated:
2020-10-27
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is minack.info ranked relative to other sites:

Percentage of visits to minack.info from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Minack.info registered?
A: Minack.info was registered 8 years, 2 months, 1 week, 4 days, 5 hours, 25 minutes, 26 seconds ago on Saturday, August 18, 2012.
Q: When was the WHOIS for Minack.info last updated?
A: The WHOIS entry was last updated 2 days, 5 hours, 25 minutes, 26 seconds ago on Tuesday, October 27, 2020.
Q: What are Minack.info's nameservers?
A: DNS for Minack.info is provided by the following nameservers:
  • ns.123-reg.co.uk
  • ns2.123-reg.co.uk
Q: Who is the registrar for the Minack.info domain?
A: The domain has been registered at Afilias Global Registry Services.
Q: What is the traffic rank for Minack.info?
A: Minack.info has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Minack.info each day?
A: Minack.info receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Minack.info resolve to?
A: Minack.info resolves to the IPv4 address 51.148.159.117.
Q: In what country are Minack.info servers located in?
A: Minack.info has servers located in the United Kingdom.
Q: What webserver software does Minack.info use?
A: Minack.info is powered by Microsoft-IIS/8.5 webserver.
Q: Who hosts Minack.info?
A: Minack.info is hosted by Zen Internet Ltd in England, Harpenden, United Kingdom, Al5.
Q: How much is Minack.info worth?
A: Minack.info has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Minack.info?

Minack.info Hosting Provider Information

Hosted IP Address:51.148.159.117
Hosted Hostname:51-148-159-117.dsl.in-addr.zen.co.uk
Service Provider:Zen Internet Ltd
Hosted Country:United KingdomGB
Location Latitude:51.8164
Location Longitude:-0.3573
Webserver Software:Microsoft-IIS/8.5

Is "Zen Internet Ltd" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Minack.info

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html
Content-Encoding: gzip
Last-Modified: Mon, 28 Sep 2020 19:45:31 GMT
Accept-Ranges: bytes
ETag: "807f58eccf95d61:0"
Vary: Accept-Encoding
Server: Microsoft-IIS/8.5
X-Powered-By: ASP.NET
X-Powered-By-Plesk: PleskWin
Date: Tue, 27 Oct 2020 13:34:00 GMT
Content-Length: 5267

Minack.info Domain Nameserver Information

HostIP AddressCountry
ns.123-reg.co.uk 212.67.202.2
ns2.123-reg.co.uk 62.138.132.21


Need to find out who hosts Minack.info?


WhoIs information for Minack.info

 Domain Name: MINACK.INFO
Registry Domain ID: D47515682-LRMS
Registrar WHOIS Server:
Registrar URL: www.domainmonster.com
Updated Date: 2020-08-07T23:19:52Z
Creation Date: 2012-08-18T14:10:02Z
Registry Expiry Date: 2021-08-18T14:10:02Z
Registrar Registration Expiration Date:
Registrar: Mesh Digital Limited
Registrar IANA ID: 1390
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registrant Organization: Jeffrey Hartley
Registrant State/Province: North Ayrshire
Registrant Country: GB
Name Server: NS.123-REG.CO.UK
Name Server: NS2.123-REG.CO.UK
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-10-27T13:33:00Z

Minack.info Free SEO Report

Website Inpage Analysis for Minack.info

H1 Headings

1 :
  1. The Minack Chronicles

H2 Headings

4 :
  1. Derek & Jeannie Tangye
  2. The Minack Chronicles
  3. Dorminack & Oliver land
  4. Oliver land - A Place for Solitude

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

24:
  1. Home
    http://minack.info/Home.html
  2. About
    http://minack.info/About.html
  3. The Minack Chronicles
    http://minack.info/The-Minack-Chronicles.html
  4. Dorminack
    http://minack.info/Dorminack.html
  5. The Way to Minack
    http://minack.info/The-Way-to-Minack.html
  6. The Tangye Archive
    http://minack.info/The-Tangye-Archive.html
  7. The Minack Cats
    http://minack.info/The-Minack-Cats.html
  8. Boris and The Donkeys
    http://minack.info/Boris-and-The-Donkeys.html
  9. Daffodils and Narcissi
    http://minack.info/Daffodils-and-Narcissi.html
  10. Oliver land
    http://minack.info/Oliver-land.html
  11. Flora and Fauna
    http://minack.info/Flora-and-Fauna.html
  12. Wildlife
    http://minack.info/Wildlife.html
  13. Jeannies Poem
    http://minack.info/Jeannies-Poem.html
  14. Cornwall Wildlife Trust
    http://minack.info/Cornwall-Wildlife-Trust.html
  15. Dereks Books
    http://minack.info/Dereks-Books.html
  16. Dereks Republished books
    http://minack.info/Dereks-Republished-books.html
  17. Jeannies Books
    http://minack.info/Jeannies-Books.html
  18. News Archive
    http://minack.info/News-Archive.html
  19. Newspapers
    http://minack.info/Newspapers.html
  20. Magazines
    http://minack.info/Magazines.html
  21. The Cornish Gardener
    http://minack.info/The-Cornish-Gardener.html
  22. Oliver land
    http://minack.info/1320620071
  23. Terms and Conditions
    http://minack.info/Terms-and-Conditions.html
  24. Privacy
    http://minack.info/Privacy-Policy.html

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Minack.info

minackcornwall wildlifechroniclescornwall wildlife trustoneoliver landbookscornisharchivewildlife trustderek and jeanniejeanniecornwallcanhomederekdorminacklamornatrustolivervisithisminack chronicleswhichtangyemakewildlifedereks0jeannieslandsolitudegreyreservejeannie tangyenaturetheir

Longtail Keyword Density for Minack.info

KeywordsOccurences
cornwall wildlife trust3
derek and jeannie3
minack chronicles4
oliver land4
jeannie tangye3
cornwall wildlife3
wildlife trust3
minack12
land8
oliver7
wildlife7
books7
tangye7
derek7
jeannie6
which6
dereks5
their5
cornwall5
dorminack5
cornish4
home4
chronicles4
jeannies4
archive4
visit3
solitude3
reserve3
nature3
make3
his3
one3
03
grey3
lamorna3
trust3
can3

Minack.info Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names

Minac.ru
L'artisanat et l'industrie – Outillage électrique
Minacall.com
恭喜,站点创建成功!
Minacciolo.it
La qualità è il punto distintivo di Minacciolo e delle sue collezioni
Minachmitts.com
Minach Mitts and Bags – Minach Mitts & Bags
Minachu.com
Mina CHU
Minachuong.com
minachuong.com - Registered at Namecheap.com
Minaci-records.com
Minaci Records – Provokant aber Kreativ!
Minaciesysmangerusara.com
This site is under development

Recently Updated Websites

Loweseger.com 3 seconds ago.Keywordscope.com 4 seconds ago.Japanshopping.org 4 seconds ago.Eventoevangelico.com.br 4 seconds ago.Eretzyisroel.org 4 seconds ago.Hostsofamerica.com 4 seconds ago.Karapo.com 5 seconds ago.Efitnessgear.com 6 seconds ago.Uscannabiscompany.com 7 seconds ago.Businesstourism.eu 7 seconds ago.Robertqawargroup.com 8 seconds ago.Mingjialight.com 8 seconds ago.Fourquartershealthandwellness.com 9 seconds ago.Opticiensenligne.com 10 seconds ago.Manicformosaics.com 10 seconds ago.Andripeetso.com 11 seconds ago.Shauntannerphotography.com 11 seconds ago.Cropbazaar.com 11 seconds ago.Bergheim.de 11 seconds ago.Rowanhauspublishing.com 12 seconds ago.Bulbqueen.com 12 seconds ago.Purplecoral.com 12 seconds ago.Shortbreakhome.com 13 seconds ago.Midstateswoolgrowers.com 13 seconds ago.Movieoasis.com 14 seconds ago.Darshanajoshi.com 14 seconds ago.Homeitup.com 15 seconds ago.Villa-lasic.com 15 seconds ago.Raceremote.com 15 seconds ago.Radio24syv.dk 15 seconds ago.