Minecraft Official Site | Minecraft

Explore new gaming adventures, accessories, & merchandise on the Minecraft Official Site. Buy & download the game here, or check the site for the latest news.


Domain summary

SafetyHigh trust score
Year Founded
2009
Global Traffic Rank
1,868
Estimated Worth
$10,679,040
Last updated
2020-10-31
Domain label
minecraft
Domain extension
net
Domain registered:
2009-05-18
Domain updated:
2020-05-17
Statvoo Rating
B
Estimated daily income
$9,888
Estimated monthly income
$300,760

Frequently Asked Questions (FAQ)

Q: When was Minecraft.net registered?
A: Minecraft.net was registered 13 years, 1 month, 1 week, 5 days, 20 hours, 21 minutes, 11 seconds ago on Monday, May 18, 2009.
Q: When was the WHOIS for Minecraft.net last updated?
A: The WHOIS entry was last updated 2 years, 1 month, 1 week, 6 days, 20 hours, 21 minutes, 11 seconds ago on Sunday, May 17, 2020.
Q: What are Minecraft.net's nameservers?
A: DNS for Minecraft.net is provided by the following nameservers:
  • ns-1395.awsdns-46.org
  • ns-154.awsdns-19.com
  • ns-2028.awsdns-61.co.uk
  • ns-575.awsdns-07.net
Q: Who is the registrar for the Minecraft.net domain?
A: The domain has been registered at TUCOWS DOMAINS INC..
Q: What is the traffic rank for Minecraft.net?
A: Minecraft.net ranks 1,868 globally on Alexa. Minecraft.net has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Minecraft.net each day?
A: Minecraft.net receives approximately 1,235,955 visitors and 9,887,640 page impressions per day.
Q: What IP address does Minecraft.net resolve to?
A: Minecraft.net resolves to the IPv4 address 99.86.251.50.
Q: In what country are Minecraft.net servers located in?
A: Minecraft.net has servers located in the United States.
Q: What webserver software does Minecraft.net use?
A: Minecraft.net is powered by CloudFront webserver.
Q: Who hosts Minecraft.net?
A: Minecraft.net is hosted by AT&T Services, Inc. in Washington, Seattle, United States, 98108.
Q: How much is Minecraft.net worth?
A: Minecraft.net has an estimated worth of $10,679,040. An average daily income of approximately $9,888, which is roughly $300,760 per month.

Minecraft.net Reviews

We have 1 review(s) for Minecraft.net

Add your review
Verified

 (8 months ago)
 

"Minecraft Trial"


Minecraft is an open-ended game where you decide what adventure you want to take. Explore infinite worlds and build everything from the simplest of homes to the grandest of castles

Minecraft.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Minecraft.net

H1 Headings

1 :
  1. Welcome to Minecraft

H2 Headings

7 :
  1. Explore Minecraft Games
  2. Newest News
  3. Celebrate Halloween
  4. Minecraft Dungeons Spooky Fall Event
  5. Realms Plus is available now
  6. Minecraft Marketplace
  7. Community Creations

H3 Headings

12 :
  1. Minecraft
  2. Minecraft Dungeons
  3. Minecraft Earth
  4. Minecraft: Education Edition
  5. Minecraft
  6. Minecraft dungeons
  7. Minecraft earth
  8. Minecraft: Education Edition
  9. Goats and powder snow now in Bedrock Beta
  10. New on Java Realms: Fear Itself
  11. Spooky Fall Event is now live
  12. Halloween comes to Minecraft Marketplace

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

26 :

Links - Internal

40:

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Minecraft.net

yourxboxoneonlineswitchnewworldmoremultiplayerfall eventspooky fall eventplaystationnintendocommunityspooky fallnewsdungeonsnintendo switchmarketplacegamesminecraftfallspookyeventminecraft dungeonsrealmshalloweengetnowonline multiplayerexplorexbox oneplay

Who hosts Minecraft.net?

Minecraft.net Hosting Provider Information

Hosted IP Address:99.86.251.50
Hosted Hostname:server-99-86-251-50.lhr3.r.cloudfront.net
Service Provider:AT&T Services, Inc.
Hosted Country:United StatesUS
Location Latitude:47.54
Location Longitude:-122.3032
Webserver Software:CloudFront

Is "AT&T Services, Inc." in the Top 10 Hosting Companies?

Name
Percentage
Unknown
21.6445%
GOOGLE
14.1050%
AS-26496-GO-DADDY-COM-LLC
3.4726%
NAMECHEAP-NET
3.1524%
AMAZON-AES
2.2226%
GoDaddy.com, LLC
2.0265%
UNIFIEDLAYER-AS-1
1.9734%
Fara Negar Pardaz Khuzestan
1.6251%
CONFLUENCE-NETWORK-INC
1.4696%
AMAZON-02
1.3660%
AT&T Services, Inc.
0.1909%

Minecraft.net Domain Nameserver Information

HostIP AddressCountry
ns-1395.awsdns-46.org 205.251.197.115
ns-154.awsdns-19.com 205.251.192.154
ns-2028.awsdns-61.co.uk 205.251.199.236
ns-575.awsdns-07.net 205.251.194.63

Websites with Similar Names

Minec-rd.online
Домен зарегистрирован через «Джино»
Minec.gob.sv
Ministerio de Economía de El Salvador – Sitio web del Ministerio de Economía de El Salvador
Minec.org
minec อยากรู้มาที่นี่ เรื่องดีๆมีอีกเยอะ
Minec.ru
Домен minec.ru продается
Minecaa.club
Harp Substitute
Minecablerepair.com
Consolidated Corporations
Minecade.com
Enjin Security - Request Blocked
Minecadiasmp.com
Squarespace - Website Expired

Recently Updated Websites

Aocliente.online (7 seconds ago.)Partspager.com (7 seconds ago.)Zaboristo2020.ru (8 seconds ago.)Massimo.in.ua (9 seconds ago.)Mipmip.org (12 seconds ago.)Alpenandglo.com (14 seconds ago.)Onandon.org.hk (15 seconds ago.)Anacyte.com (17 seconds ago.)Malosos.com (17 seconds ago.)Midcheshirerail.org.uk (18 seconds ago.)Msjnews.com (18 seconds ago.)Wetheoriginalpeople.com (20 seconds ago.)Peatreecreations.net (22 seconds ago.)305yachtcharters.com (24 seconds ago.)Yeahboy.com.au (25 seconds ago.)Openmind.org (27 seconds ago.)Renovationbrampton.com (27 seconds ago.)Mycoronacure.today (28 seconds ago.)Colaisteide.ie (29 seconds ago.)Ibr.is (32 seconds ago.)Themodernproducts.us (34 seconds ago.)Barieli.com (36 seconds ago.)Xenaskincare.com (37 seconds ago.)Berlinstories.org (37 seconds ago.)Zkydxin.com (38 seconds ago.)Necesitopresupuesto.com (39 seconds ago.)Flyereclipse.com (40 seconds ago.)Lastfrontiertravel.com (41 seconds ago.)Hyperarchitects.com (42 seconds ago.)Protexinvet.com (43 seconds ago.)

Recently Searched Keywords

wettcarwash (1 second ago.)rights and clearance (1 second ago.)everything you need to know about the new ipad may 08, 2018 (1 second ago.)cyber 6 intro (1 second ago.)pussy tip me (1 second ago.)nightmares ii (2 seconds ago.)dn k (2 seconds ago.)real fun (3 seconds ago.)자동차 콧구멍 바꿔줌 1 (3 seconds ago.)alisocanyonpark.com (3 seconds ago.)everything you need (3 seconds ago.)life insurance (3 seconds ago.)var pageblock (4 seconds ago.)boho babe mini dress mocha (5 seconds ago.)구인 (5 seconds ago.)webnodella (5 seconds ago.)evangelion: 3.0 1.0 thrice upon a time (6 seconds ago.)towards helping (6 seconds ago.)everything you (6 seconds ago.)организация торжеств (6 seconds ago.)nbspnbsp april (7 seconds ago.)donnes personnelles dans (7 seconds ago.)mila i - fondos (7 seconds ago.)zuschauer vs publikum (7 seconds ago.)classtermsofusedescriptionu003eyou (7 seconds ago.)location services (8 seconds ago.)hiciste conjugation (8 seconds ago.)series monobolo series (8 seconds ago.)jungle scout free (9 seconds ago.)histoire-passion (9 seconds ago.)