Ministryofgrace.net  |  Coming Soon
Low trust score  | 



Ministryofgrace.net Website Information

Website Ranks & Scores for Ministryofgrace.net

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:0
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Domain Information for Ministryofgrace.net

Domain Registrar: GODADDY.COM, LLC
Registration Date:2016-06-02  2 years 11 months 2 weeks ago
Last Modified:2018-06-03  11 months 2 weeks 4 days ago
Expiration Date:2018-09-25  7 months 3 weeks 2 days ago

Whois information for ministryofgrace.net

Full Whois Lookup for Ministryofgrace.net Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Ministryofgrace.net. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: MINISTRYOFGRACE.NET
Registry Domain ID: 2033261167_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.godaddy.com
Registrar URL: http://www.godaddy.com
Updated Date: 2018-06-03T14:42:55Z
Creation Date: 2016-06-02T23:44:24Z
Registry Expiry Date: 2020-06-02T23:44:24Z
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: 480-624-2505
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.WEBHOSTINGHUB.COM
Name Server: NS2.WEBHOSTINGHUB.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-09-25T09:36:56Z

Who hosts Ministryofgrace.net?

Ministryofgrace.net is hosted by Corporate Colocation Inc. in California, Los Angeles, United States, 90039.
Ministryofgrace.net has an IP Address of 205.134.241.77 and a hostname of whub34.webhostinghub.com and runs Apache web server.



Ministryofgrace.net Web Server Information

Hosted IP Address:205.134.241.77
Hosted Hostname:whub34.webhostinghub.com
Service Provider:Corporate Colocation Inc.
Hosted Country:United StatesUS
Location Latitude:34.1173
Location Longitude:-118.26
Webserver Software:Apache

HTTP Header Analysis for Ministryofgrace.net

Http-Version: 1.1
Status-Code: 503
Status: 503 Service Temporarily Unavailable
Date: Tue, 25 Sep 2018 09:37:08 GMT
Server: Apache
X-Powered-By: PHP/5.4.45
Retry-After: 86400
Upgrade: h2,h2c
Connection: Upgrade, close
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8


Need to find out who hosts Ministryofgrace.net?

Ministryofgrace.net Free SEO Report

Website Inpage Analysis for Ministryofgrace.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Ministryofgrace.net

1bodywidthelsesubscribe0returnif bodywidthvariffalseimgclasswpsmcsppageremoveclasspagecurrentsocialsvglayoutimgidwpsmcsppageremoveclasspagecurrent nextpaneladdclasspagecurrentnextpaneladdclasspagecurrentnavigationcontentsettimeoutfunctionsubscribeemailvalemailtoggleflagtruebodywidth 1080functionreturn falsesocialblocksubmitbuttonpropdisabledtoggle

Longtail Keyword Density for Ministryofgrace.net

KeywordsOccurences
if bodywidth4
bodywidth 10804
wpsmcsppageremoveclasspage-current nextpaneladdclasspage-current4
return false3
var24
if10
function9
else7
false7
toggleflag6
bodywidth6
svg6
04
wpsmcsppageremoveclasspage-current4
return4
social4
14
settimeoutfunction4
nextpaneladdclasspage-current4
subscribeemailval3
subscribe3
email3
social-block3
navigationcontent3
imgclass3
imgid3
layout3
true3
toggle3
submitbuttonpropdisabled3

What are the nameservers for ministryofgrace.net?

Ministryofgrace.net Domain Nameserver Information

HostIP AddressCountry
ns1.webhostinghub.com 209.182.197.185United States United States
ns2.webhostinghub.com 173.205.127.4United States United States

Ministryofgrace.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Ministryofgrace.net is a scam?