Mjolknabben.se Favicon Mjolknabben.se

Mjolknabben.se Website Thumbnail
Checking...
Mjölknabben
Low trust score
Add a review Change category Claim this site

Domain summary

Domain label
mjolknabben
Domain extension
se
Domain registered:
2012-04-10
Domain updated:
2020-09-09
Domain expires:
2021-04-10
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is mjolknabben.se ranked relative to other sites:

Percentage of visits to mjolknabben.se from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Mjolknabben.se registered?
A: Mjolknabben.se was registered 8 years, 5 months, 2 weeks, 6 days, 3 hours, 21 minutes, 32 seconds ago on Tuesday, April 10, 2012.
Q: When was the WHOIS for Mjolknabben.se last updated?
A: The WHOIS entry was last updated 3 weeks, 3 hours, 21 minutes, 32 seconds ago on Wednesday, September 9, 2020.
Q: What are Mjolknabben.se's nameservers?
A: DNS for Mjolknabben.se is provided by the following nameservers:
  • ns7.binero.se
  • ns6.binero.se
  • ns5.binero.se
  • ns4.binero.se
  • ns3.binero.se
Q: Who is the registrar for the Mjolknabben.se domain?
A: The domain has been registered at NIC-SE.
Q: What is the traffic rank for Mjolknabben.se?
A: Mjolknabben.se has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Mjolknabben.se each day?
A: Mjolknabben.se receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Mjolknabben.se resolve to?
A: Mjolknabben.se resolves to the IPv4 address 195.74.38.155.
Q: In what country are Mjolknabben.se servers located in?
A: Mjolknabben.se has servers located in the Sweden.
Q: What webserver software does Mjolknabben.se use?
A: Mjolknabben.se is powered by Apache webserver.
Q: Who hosts Mjolknabben.se?
A: Mjolknabben.se is hosted by Binero AB in Sweden.
Q: How much is Mjolknabben.se worth?
A: Mjolknabben.se has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Mjolknabben.se?

Mjolknabben.se Hosting Provider Information

Hosted IP Address:195.74.38.155
Hosted Hostname:cl-46.atm.binero.net
Service Provider:Binero AB
Hosted Country:SwedenSE
Location Latitude:59.3247
Location Longitude:18.056
Webserver Software:Apache

Is "Binero AB" in the Top 10 Hosting Companies?

Name
Percentage

HTTP Header Analysis for Mjolknabben.se

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Wed, 09 Sep 2020 01:38:35 GMT
Server: Apache
X-Powered-By: PHP/7.2.10
X-Pingback: http://mjolknabben.se/xmlrpc.php
X-Redirect-By: WordPress
Location: https://mjolknabben.se/
Content-Length: 0
Content-Type: text/html; charset=UTF-8

Mjolknabben.se Domain Nameserver Information

HostIP AddressCountry
ns7.binero.se 195.74.39.30
ns6.binero.se 185.42.137.126
ns5.binero.se 194.58.193.124
ns4.binero.se 185.42.137.108
ns3.binero.se 194.58.193.60


Need to find out who hosts Mjolknabben.se?


WhoIs information for Mjolknabben.se

 # Copyright (c) 1997- The Swedish Internet Foundation.
# All rights reserved.
# The information obtained through searches, or otherwise, is protected
# by the Swedish Copyright Act (1960:729) and international conventions.
# It is also subject to database protection according to the Swedish
# Copyright Act.
# Any use of this material to target advertising or
# similar activities is forbidden and will be prosecuted.
# If any of the information below is transferred to a third
# party, it must be done in its entirety. This server must
# not be used as a backend for a search engine.
# Result of search for registered domain names under
# the .se top level domain.
# This whois printout is printed with UTF-8 encoding.
#
state: active
domain: mjolknabben.se
holder: (not shown)
admin-c: -
tech-c: -
billing-c: -
created: 2012-04-10
modified: 2020-01-16
expires: 2021-04-10
transferred: 2014-06-19
nserver: ns3.binero.se
nserver: ns4.binero.se
nserver: ns5.binero.se
nserver: ns6.binero.se
nserver: ns7.binero.se
dnssec: signed delegation
registry-lock: unlocked
status: ok
registrar: Loopia Group AB

Mjolknabben.se Free SEO Report

Website Inpage Analysis for Mjolknabben.se

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

5 :
  1. SMÖRGÅSTÅRTOR OCH LANDGÅNGAR
  2. FISKEKORT PÅ IFISKE.SE
  3. KÖP CAMPING KEY EUROPE HÄR
  4. 38 MOTORCYKLAR – ETT GLATT GÄNG
  5. VÄXJÖ SPORTVAGNSKLUBB

H4 Headings

4 :
  1. Amy's Kafé
  2. Boende
  3. Natur
  4. Köp kort här

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

17 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-47720579-1

Links - Internal

28:
  1. Hem
    https://mjolknabben.se/
  2. Aktiviteter
    https://mjolknabben.se/aktiviteter/
  3. Boende
    https://mjolknabben.se/boende/
  4. Stugor
    https://mjolknabben.se/boende/stugor/
  5. Camping
    https://mjolknabben.se/boende/camping/
  6. Annexet
    https://mjolknabben.se/boende/annexet/
  7. Lyckan husen
    https://mjolknabben.se/boende/lyckanhusen/
  8. Amy’s kafé
    https://mjolknabben.se/amys-kafe/
  9. Turistinfo
    https://mjolknabben.se/turistinfo/
  10. Blogg
    https://mjolknabben.se/blogg/
  11. Kontakt/Priser
    https://mjolknabben.se/kontakt/
  12. No text
    http://mjolknabben.se/?lang=sv
  13. No text
    http://mjolknabben.se/?lang=en
  14. No text
    http://mjolknabben.se/?lang=de
  15. No text
    http://mjolknabben.se/
  16. No text
    http://mjolknabben.se/amys-kafe/
  17. No text
    http://mjolknabben.se/boende/stugor/
  18. No text
    http://mjolknabben.se/turistinfo/
  19. No text
    http://mjolknabben.se/mjolknabben/kop-camping-key-europe-har/
  20. Amys Kafe
    https://mjolknabben.se/category/amyskafe/
  21. Mjölknabben
    https://mjolknabben.se/category/mjolknabben/
  22. No text
    https://mjolknabben.se/mjolknabben/smorgastartor-och-landgangar/
  23. Aktiviteter
    https://mjolknabben.se/category/aktiviteter/
  24. No text
    https://mjolknabben.se/mjolknabben/fiskekort-pa-ifiske-se/
  25. No text
    https://mjolknabben.se/mjolknabben/kop-camping-key-europe-har/
  26. Okategoriserade
    https://mjolknabben.se/category/okategoriserade/
  27. No text
    https://mjolknabben.se/okategoriserade/38-motorcyklar-ett-glatt-gang/
  28. No text
    https://mjolknabben.se/okategoriserade/vaxjo-sportvagnsklubb/

Links - Internal (nofollow)

0:

Links - Outbound

2:
  1. No text
    http://www.visitasnen.se
  2. No text
    https://www.facebook.com/mjolknabben

Links - Outbound (nofollow)

0:

Keyword Cloud for Mjolknabben.se

newkpfrnvarmedimagekafecampingstylersdumylatlngcreatestylesmjlknabbenmappositionkafe mjlknabbenamysfalsekafdenamys kafe mjlknabbenp0amys kafeochaktiviteterboende

Longtail Keyword Density for Mjolknabben.se

KeywordsOccurences
amys kafe mjlknabben4
amys kafe4
kafe mjlknabben4
new9
map8
var8
amys6
mjlknabben5
camping5
false5
och5
p4
mylatlng4
image4
med4
kafe4
kaf4
boende3
frn3
03
kp3
den3
du3
create3
styles3
stylers3
position3
aktiviteter3

Mjolknabben.se Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Mjolknabben.se is a scam?

Websites with Similar Names

Mjolk-decor.com
mjolk-decor.com
Mjolk.ca
Mjolk - Mjölk
Mjolk.cz
mjölk
Mjolkgirot.org
Apache2 Debian Default Page: It works
Mjolkhomme.com
鸿禾娱乐注册平台-鸿禾娱乐推荐网站
Mjolkmovies.com
Mjölk Movies
Mjolknabben.se
Mjölknabben

Recently Updated Websites

Alitheamericanhero.org 1 second ago.Turkijereisburo.nl 1 second ago.Techfreak.website 3 seconds ago.Vighnahartaenterprises.com 3 seconds ago.Debraazar.net 4 seconds ago.Bonusmobilya.com.tr 4 seconds ago.Fkanorway.org 5 seconds ago.Secureinternetshop.net 7 seconds ago.Roubinirugs.com 7 seconds ago.B195.com 8 seconds ago.Archangelavia.com 8 seconds ago.Corp-email.com 8 seconds ago.Greggdurkin.com 9 seconds ago.Ginza-hakusan.com 9 seconds ago.Taiyingstone.com 10 seconds ago.Valisecabine.info 10 seconds ago.Electroniki.com.gr 10 seconds ago.Cgcmirasi.com 10 seconds ago.Tone-man.com 10 seconds ago.Vin-musoleu.com 11 seconds ago.Tropicalpainting.com 11 seconds ago.Bodani.com 13 seconds ago.Tomaterafonline.com 13 seconds ago.Intercultura.it 13 seconds ago.Aspoonfulofalice.com 15 seconds ago.Css-grid.com 16 seconds ago.Qatarpak.org 16 seconds ago.Teslamedek.com 16 seconds ago.Infognomon.com 17 seconds ago.Xn--fhq1c916a5l7dmli.jp 17 seconds ago.