Website Thumbnail
Best MLM Software Company India, Free Demo, Top Multilevel Marketing Software in India
High trust score
Add a review Change category
Best MLM Software Company in India is Tech Genius. We give advanced, professional Multilevel Marketing Software at low cost in India with free Software Demo.

Domain summary

Domain label
Domain extension
Global Traffic Rank
Statvoo Rating
Trust Score
High trust score
Estimated worth
Estimated daily income
Estimated monthly income

Rank summary

How is ranked relative to other sites:

Percentage of visits to from a search engine:

Frequently Asked Questions (FAQ)

Q: When was registered?
A: was registered 2 weeks, 7 hours, 46 minutes, 5 seconds ago on Friday, October 16, 2020.
Q: When was the WHOIS for last updated?
A: The WHOIS entry was last updated 2 weeks, 7 hours, 46 minutes, 5 seconds ago on Friday, October 16, 2020.
Q: Who is the registrar for the domain?
A: The domain has been registered at .
Q: What is the traffic rank for
A: has a High trust score, and a Statvoo Rank of I.
Q: How many people visit each day?
A: receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does resolve to?
A: resolves to the IPv4 address
Q: In what country are servers located in?
A: has servers located in the India.
Q: What webserver software does use?
A: is powered by Microsoft-IIS/10.0 webserver.
Q: Who hosts
A: is hosted by LUMOS Networks, Inc. in Maharashtra, Mumbai, India, 400070.
Q: How much is worth?
A: has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Hosting Provider Information

Hosted IP Address:
Hosted Hostname:
Service Provider:LUMOS Networks, Inc.
Hosted Country:IndiaIN
Location Latitude:19.0748
Location Longitude:72.8856
Webserver Software:Microsoft-IIS/10.0

Is "LUMOS Networks, Inc." in the Top 10 Hosting Companies?


HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: max-age=1296000
Content-Type: text/html
Content-Encoding: gzip
Last-Modified: Mon, 12 Oct 2020 12:41:40 GMT
Accept-Ranges: bytes
ETag: "1eeba2895a0d61:0"
Vary: Accept-Encoding
Server: Microsoft-IIS/10.0
X-Powered-By: ASP.NET
Date: Fri, 16 Oct 2020 08:23:01 GMT
Content-Length: 17428 Domain Nameserver Information

HostIP AddressCountry

Need to find out who hosts

WhoIs information for Free SEO Report

Website Inpage Analysis for

H1 Headings

1 :
  1. Best MLM SoftwareCompany in India

H2 Headings

4 :
  1. What is Called MLM Software
  2. Why Choose This Top MLM Software Company in India?
  3. Features of the Top MLM Software
  4. What Are the Advantages of our Latest MLM Software Service?

H3 Headings

13 :
  1. E-Commerce Integration
  2. Professional Support
  3. User Friendly
  6. 24X7 Helpdesk
  7. Latest MLM Software for All Multilevel Marketing Business Plans
  8. 13 Years Experience as MLM ERP Software Maker
  11. Algorithm of our Working Procedure
  12. What People Say
  13. Follow Us on

H4 Headings

41 :
  1. 1. Intelligent and Data Driven Solution
  2. 2. Decade Long Expertise in Coding with PHP, Asp.NET, Python and JavaScript
  3. 3. Free MLM Software Demo
  4. 4. Suitable for Small and Big Organizations
  17. Requirements Analysis
  18. Planning
  19. Design
  20. Coding
  21. Unit Testing
  22. Acceptance Testing
  23. Implementation
  24. Training
  25. 1st Stage
  26. 2nd Stage
  27. 3rd Stage
  28. 4th Stage
  29. Easy Integration:
  30. Accessibility:
  31. Manage databases and resources :
  32. User Friendly Interface:
  33. Affordable Packages:
  34. MLM Software at Monthly Charges:
  35. Multiple Languages Support:
  36. Online-Wallet and UPI Support:
  37. MLM Software and Website Designing:
  38. Leads Generation, Tracking and Distribution:
  39. Abir Khan Single Line MLM Company
  40. Travis Hannon MLM Business Professional
  41. Dev Robin Binary MLM Business Expert

H5 Headings

4 :

H6 Headings

0 :


0 :

Total Images

24 :

Google Adsense

Not Applicable

Google Analytics


Links - Internal

  1. No text
  2. Home
  3. About Us
  4. Service Area
  5. Ranchi
  6. Patna
  7. Delhi
  8. Rajasthan
  9. UP-Agra
  10. Lucknow-Kanpur
  11. Gujarat
  12. Punjab-Haryana
  13. Kolkata-Howrah
  14. Uttarakhand
  15. Kerala
  17. Binary Software
  18. Australian Binary Software
  19. Contact
  20. learn more
  21. contact us
  22. Tech Genius Solutions
  23. 12 different types of MLM compensation plans
  24. Binary
  25. Australian Binary
  26. Sitemap
  27. RSS

Links - Internal (nofollow)


Links - Outbound

  1. No text
  2. No text
  3. No text
  4. No text
  5. No text

Links - Outbound (nofollow)


Keyword Cloud for

generationmanagementtech geniusjustbestcodingorganizationplanbusiness managementbuildapplication softwaremarketing0indiabinary softwaremarketing applicationworkingecommercespillovertheirworktopmakedataimportanttop mlmbusinesseslevel marketingtechboardbest mlmsalesapplicationmlm software companysolutionscompany in indiaoursoftware companymlm software demodifferentcompensationyourmanyofferwe knowbinarycanlongfreeexperiencegeniusdirectupworldlatestwe havespillover binarymlm businessonlinecompanyyouknowmorealsoprofessionaldevelopmentaustralianmultimarketing businessmlm erpbusinessmlmiftheredevelopplansthemyou canxupmlm softwareweteamsoftwaresincedevelopersadvancedtop mlm softwaremulti levellevelerpanalysiswishgiftmultilevel marketingsystemapplicationsaustralian binaryaffiliateverynetworkmulti level marketingcustominformationothermanagenetwork marketingsoftware democlientsrelatedkindssuitablesolutionstrategiesstagemultilevelall kindsmatrixyearstheyhelpaffiliate marketingyour businessfeaturesaffiliate marketing applicationsupportpartyhavethroughallcompensation plansussellingdemo

Longtail Keyword Density for

mlm software company3
company in india3
affiliate marketing application3
multi level marketing3
top mlm software3
mlm software demo3
mlm software18
network marketing7
marketing application6
you can6
multilevel marketing5
we have5
multi-level marketing4
business management4
multi level4
affiliate marketing4
software demo4
tech genius4
marketing business4
all kinds3
top mlm3
mlm erp3
binary software3
level marketing3
compensation plans3
application software3
australian binary3
we know3
mlm business3
software company3
best mlm3
spillover binary3
your business3
long3 Reviews

We have 1 review(s) for

Add your review
Verified India

 (1 week ago)

"Leading MLM Software Development Company in India"

MLM Software Pro is an excellent business management tool that can be used in Multilevel Marketing industry. The developer of this MLM Software is Tech Genius Solutions from Kolkata, India. Tech Genius is having 13+ years of experience and expertise in making and distributing cutting edge Network Marketing Software. This application comes with free software demo.

Websites with Similar Names
MLM Social - The Social Network for Network Marketers
Mlm Softwares - Mlm Software Company in India
Top MLM Software Company,Network Marketing Software,India
MLM Software Developers - Sangli, Karad, Satara, Pune, Mumbai, Solapur, Nashik | MLM Software - Binary, Generation, Repurchase, Single-Leg, Daily cutoff, Timely-Hourly Cutoff | MLM Software Developers & Consultants - Sangli, Karad, Satara, Kolhapur, Pune, Mumbai
✓ 𝗠𝗟𝗠 𝗦𝗼𝗳𝘁𝘄𝗮𝗿𝗲 𝗖𝗼𝗺𝗽𝗮𝗻𝘆 ✓ 𝟲𝟭𝟵-𝟳𝟳𝟬-𝟳𝟭𝟬𝟳. MLM Software for Company and Distributors 1-888-221-0106
MLM Software Chennai Tamilnadu , Multilevel Marketing software Chennai India - MLM Software Chennai Tamilnadu , Multilevel Marketing software Chennai India | MLM Software Chennai Tamilnadu , Multilevel Marketing software Chennai India

Recently Updated Websites 2 seconds 2 seconds 3 seconds 3 seconds 4 seconds 4 seconds 5 seconds 5 seconds 6 seconds 6 seconds 7 seconds 8 seconds 8 seconds 8 seconds 8 seconds 8 seconds 9 seconds 10 seconds 10 seconds 10 seconds 10 seconds 13 seconds 13 seconds 13 seconds 14 seconds 14 seconds 14 seconds 14 seconds 14 seconds 15 seconds ago.