Mma-russia.ru

Website Thumbnail
Checking...
Р.О.Д.Ъ. - Клуб смешанных единоборств

Safety: Low trust score
Year Founded: 2010
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-24
Category: This site has not been categorized yet

Сайт спортивной команды и клуба Р.О.Д.Ъ. Москва 2014г.


Domain summary

Domain label
mma-russia
Domain extension
ru
Domain registered:
2010-03-14
Domain updated:
2020-10-24
Domain expires:
2021-03-14
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is mma-russia.ru ranked relative to other sites:

Percentage of visits to mma-russia.ru from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Mma-russia.ru registered?
A: Mma-russia.ru was registered 10 years, 8 months, 2 weeks, 19 hours, 40 minutes, 52 seconds ago on Sunday, March 14, 2010.
Q: When was the WHOIS for Mma-russia.ru last updated?
A: The WHOIS entry was last updated 1 month, 4 days, 19 hours, 40 minutes, 52 seconds ago on Saturday, October 24, 2020.
Q: What are Mma-russia.ru's nameservers?
A: DNS for Mma-russia.ru is provided by the following nameservers:
  • ns1.jino.ru
  • ns2.jino.ru
Q: Who is the registrar for the Mma-russia.ru domain?
A: The domain has been registered at RU-CENTER-REG-RIPN.
Q: What is the traffic rank for Mma-russia.ru?
A: Mma-russia.ru has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Mma-russia.ru each day?
A: Mma-russia.ru receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Mma-russia.ru resolve to?
A: Mma-russia.ru resolves to the IPv4 address 81.177.135.12.
Q: In what country are Mma-russia.ru servers located in?
A: Mma-russia.ru has servers located in the Russia.
Q: What webserver software does Mma-russia.ru use?
A: Mma-russia.ru is powered by Pepyaka/1.19.0 webserver.
Q: Who hosts Mma-russia.ru?
A: Mma-russia.ru is hosted by OJSC RTComm.RU in Moscow, Moscow, Russia, 129110.
Q: How much is Mma-russia.ru worth?
A: Mma-russia.ru has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Mma-russia.ru Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Mma-russia.ru Free SEO Report

Website Inpage Analysis for Mma-russia.ru

H1 Headings

0 :

H2 Headings

2 :
  1. ТЕЛЕФОН КЛУБА: +7 985 145-69-36
  2. [email protected]

H3 Headings

0 :

H4 Headings

1 :
  1. НОВЫЙ АДРЕС ЗАЛА:  г. Люберцы, ул. Кирова, д. 34

H5 Headings

0 :

H6 Headings

3 :
  1. Главная новость
  2. Новости единоборств
  3. Наши друзья

Total IFRAMEs

5 :

Total Images

11 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

27:
  1. https://www.rodmma.com/single-post/2016/08/29/%D0%A2%D1%80%D0%B5%D0%BD%D0%B8%D1%80%D0%BE%D0%B2%D0%BA%D0%B8-%D0%B4%D0%BB%D1%8F-%D0%BD%D0%BE%D0%B2%D0%B8%D1%87%D0%BA%D0%BE%D0%B2-%D1%81-%D0%BD%D1%83%D0%BB%D0%B5%D0%B2%D1%8B%D0%BC-%D1%83%D1%80%D0%BE%D0%B2%D0%BD%D0%B5%D0%BC-%D0%B2-%D0%BA%D0%BB%D1%83%D0%B1%D0%B5-%D0%A0%D0%9E%D0%94%D0%AA
    https://www.rodmma.com/single-post/2016/08/29/%D0%A2%D1%80%D0%B5%D0%BD%D0%B8%D1%80%D0%BE%D0%B2%D0%BA%D0%B8-%D0%B4%D0%BB%D1%8F-%D0%BD%D0%BE%D0%B2%D0%B8%D1%87%D0%BA%D0%BE%D0%B2-%D1%81-%D0%BD%D1%83%D0%BB%D0%B5%D0%B2%D1%8B%D0%BC-%D1%83%D1%80%D0%BE%D0%B2%D0%BD%D0%B5%D0%BC-%D0%B2-%D0%BA%D0%BB%D1%83%D0%B1%D0%B5-%D0%A0%D0%9E%D0%94%D0%AA
  2. Mma-russia ПЕРСОНАЛЬНЫЕ ТРЕНИРОВКИ
    https://www.rodmma.com/personalnye-trenirovki
  3. Mma-russia ДЕТСКИЕ ГРУППЫ В КЛУБЕ "Р.О.Д.Ъ."
    https://www.rodmma.com/detskie-gruppy
  4. Mma-russia КЛУБНАЯ ЭКИПИРОВКА @rodshop_official
    https://www.instagram.com/rodshop_official/?hl=en
  5. http://beloyar.net/index.php
    http://beloyar.net/index.php
  6. http://rusvita.ru/
    http://rusvita.ru/
  7. https://nikola-emelin.ru/
    https://nikola-emelin.ru/
  8. https://www.mc-algyda.ru/
    https://www.mc-algyda.ru/
  9. https://www.rodmma.com
    https://www.rodmma.com
  10. Mma-russia РАСПИСАНИЕ
    https://www.rodmma.com/raspisanie
  11. Mma-russia ПРАВИЛА КЛУБА
    https://www.rodmma.com/--c231k
  12. Mma-russia ВСТУПИТЬ В КЛУБ
    https://www.rodmma.com/form
  13. Mma-russia INSTAGRAM RODMMA
    https://instagram.com/rodmma.official/
  14. Mma-russia Политика конфиденциальности персональных данных
    https://www.rodmma.com/kopiya-novichkam
  15. Mma-russia ДЕТСКИЕ ГРУППЫ КАЖДЫЙ РАБОЧИЙ ДЕНЬ
    https://www.rodmma.com/raspisanie
  16. Mma-russia Наш магазин @rodshop_official
    https://www.instagram.com/rodshop_official/?hl=en
  17. http://vk.com/club19254659
    http://vk.com/club19254659
  18. http://www.youtube.com/user/MrZoolus
    http://www.youtube.com/user/MrZoolus
  19. https://instagram.com/rodmma.official/
    https://instagram.com/rodmma.official/
  20. https://www.facebook.com/groups/1647099035579112/
    https://www.facebook.com/groups/1647099035579112/
  21. Mma-russia ГЛАВНАЯ
    https://www.rodmma.com
  22. Mma-russia НОВИЧКАМ
    https://www.rodmma.com/novichkam
  23. Mma-russia СТОИМОСТЬ
    https://www.rodmma.com/stoimost
  24. Mma-russia О КЛУБЕ
    https://www.rodmma.com/o-klube
  25. Mma-russia МЫ В ЛИЦАХ
    https://www.rodmma.com/my-v-litcah
  26. Mma-russia МЫ в СОЦ.СЕТЯХ
    https://www.rodmma.com/my-v-soc-setyah
  27. Mma-russia КОНТАКТЫ
    https://www.rodmma.com/map

Links - Outbound (nofollow)

0:

Keyword Cloud for Mma-russia.ru

border012px14emol74 1 0pxcolor373737fontfamilyhelveticaselectdatapreviewerror stylejmga8at2menucontainerarrow255 1 stylejmga8at2menucontainerleft10pxright10pxhelveticaneuew0155roma helveticaneuew0255romarodimportantstylejmga8at2itemcolor0099fftextdecorationunderlinecursorpointer1normal normal 12px14emnormalcursorpointer1pxstylejmga8at2itemhoverareafirstchildselectdatapreviewhover0s backgroundcolor 04swidth100height100backgroundrgba255 255 255255 128 360 0stylejmga8at2menucontainercenterdirectionborderstylesolidbordercolorrgba249lb1itemscontainernormal normal normalstylejmga8at2submenuddm1navcontainerarrow ddm1navcontainersvgcontainerhelveticaneuew1055roma helveticahelveticaneuew0255roma1bordersolid rgba74 74ddm1navcontainercenterdirection1backgroundcolorrgba255 25512px14em arial msfontnormal normal normal04s ease 0scolor373737fontfamilyhelvetica neue helveticaneuew0155romahelvetica arialbackgroundcolor 04sselectdatapreviewerrortransitioncolor0snbspborderradius0transitionbordercolor2ddm1navcontainerarrowddm1navcontainerleftdirectionborderwidth2px borderstylesolidbordercolorrgba249colorstylejmga8at2item borderradius0b3linkminheightauto importantborderstylesolidbordercolorrgba249 249 249displaynone0ddm1navcontainerultxtnew ol12px14em arialselectdataerrortrueopen249 1backgroundcolorrgba255borderwidth2pxbordercolorrgba20414px14em arial mshelveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055romamarginleft calc100 980pxopen sanssansserif color717070ddm1navcontainerarrowddm1navcontainerrightdirection255 09fontsize0margintop5pxifneueease 0shelveticaneuew0255roma helveticaneuew1055romaneue helveticaneuew0155roma helveticaneuew0255romaborderwidth2pxbordercolorrgba204 204normal 12px14empositionfixed importantleftautonormal 12px14em arialiframewebkitfullscreenstylejmga8at2menucontainerleftdirectionsanssansserif color717070stylejmga8at2menucontainerarrow stylejmga8at2menucontainersvgcontainernormal 14px14emtxtnew ultopautobottom0stylejmga8at2menucontainersvgcontainermargin0lineheightnormalletterspacingnormalhelveticaneuew1055roma3pgothicdotumhelveticasansserif colorffffff255 255 09fontsize0margintop5px1bordersolid rgba74rgba255980px 05calc100selectfocuscalc100 980px 051 ddm1navcontainerfontfamilyhelveticaul04s easestylejmga8at2menucontainerrightdirectionstylejmga8at2submenubeforefontfamilyhelvetica neuergba74 74 74backgroundcolorrgba255 255helveticaneuew0155romaultxtnewtransitionbordercolor 04s ease168 168fontnormal normalimportantleftauto importantzindex50rgba255 255colorffffff05fontfamilyhelvetica neue helveticaneuew0155romaddm1navcontainersvgcontainernormal 14px14em arial1bordersolidselecthoverbackgroundcolor 04s ease78stylejmga8at2menucontainerarrowstylejmga8at2menucontainercenterdirectionhelvetica arial sansserifdisplaynonergba255 255 2556open sanssansserif10sansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncenterhelveticaneuew0255roma helveticaneuew1055roma helveticaselectdatapreviewfocuswidth100height100backgroundrgba255backgroundcolorrgba255 255 2551 0px04snormal normalpgothicdotumhelveticasansserifnormal normal 14px14emselectborderwidth2pxborderright0transparentcolor4a4a4apositionfixed importantleftauto importantzindex50249 249stylejmga8at2menucontainerarrowstylejmga8at2menucontainerrightdirectioniframewebkitfullscreen minheightautotransitioncolor 04sfc3bg000000font normal normaltransitioncolor 04s easestylejmga8at2submenu stylejmga8at2itemimportantleftauto14px14emarialoldirrtl74 1255 255mshelveticaneuew1055roma helvetica arial74 74 1ddm1repeaterbuttonlabelrgba0 0 0varsanssansserifpositionabsolutetop0right0bottom0left0b4labelwrapper1backgroundcolorrgba255stylejmga8at2itemhoverarealastchildwidth100height10009fontsize0margintop5pxarial sansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncenterarial sansserifdisplaynone12txtnewopacity1borderwidth2pxbordercolorrgba204 204 204ease1 stylejmga8at2menucontainer249 1backgroundcolorrgba255 255b4linkms pgothicdotumhelveticasansserif colorffffffms pgothicdotumhelveticasansserifcolor71707006rgba0borderwidth2px borderstylesolidbordercolorrgba249 249borderleft0helvetica arial sansseriffontsize14pxdisplayinlineblockverticalalignmiddlewidth100margintop10pxtextaligncenterpositionabsolutewidth100height100overflowhiddenstylejmga8at2item backgroundcolorrgba255helveticargba74b3labelwrapperstylejoeobb5obgcolor ffffffease 0s backgroundcolorminheightauto1borderradius0backgroundcolorstylejmga8at2menucontainerarrowstylejmga8at2menucontainerleftdirection255 255 1b0b0b00 06204 204marginleft calc1005positionfixedwidth100height100backgroundrgba255 255font normalddm1navcontainerleftdirectiondisplayinlineblockddm1repeaterbuttondatastatedropcolor373737fontfamilyhelvetica neuearial ms pgothicdotumhelveticasansserifpositionabsolutetop0left0color373737width100height100backgroundcolor ffffffstylejmga8at2item backgroundcolorrgba255 255solid transparentsolidtransitionbordercolor 04s0 0 06rgba74 74255 1 ddm1navcontainerneue helveticaneuew0155romabackgroundcolorrgba25574 74b4labelddm1navcontainerarrowddm1navcontainercenterdirectioncalc100 980px1backgroundcolorrgba255 255 255980px0s backgroundcolor9selectdatapreviewerror ddm1navcontainerarrowstylejmga8at2menucontainer14px14em arialarial msddm1navcontainerarrowimportantzindex50overflowhiddenfontnormalb3label0pxsansserifdisplaynoneiframewebkitfullscreen minheightauto importantmargin0lineheightnormalletterspacingnormal txtnewmarginleftfont13ol ul4iframeffffffiframe positionabsolutewidth100height100overflowhidden11249 249 1backgroundcolorrgba255rgba0 0ddm1navcontainerrightdirectionborderstylesolidbordercolorrgba249 249stylejmga8at2labelstylejmga8at2menucontainerarrow

Longtail Keyword Density for Mma-russia.ru

KeywordsOccurences
calc100 980px 0529
margin-left calc100 980px29
04s ease 0s18
arial ms pgothicdotumhelveticasans-serif15
255 255 114
normal normal normal11
font normal normal11
1background-colorrgba255 255 2559
neue helveticaneuew01-55roma helveticaneuew02-55roma8
border-width2px border-stylesolidborder-colorrgba249 2498
border-stylesolidborder-colorrgba249 249 2498
249 249 1background-colorrgba2558
249 1background-colorrgba255 2558
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma8
rgba74 74 748
helveticaneuew02-55roma helveticaneuew10-55roma helvetica8
helveticaneuew10-55roma helvetica arial8
fontnormal normal normal7
normal normal 14px14em6
74 74 16
14px14em arial ms6
normal 14px14em arial6
background-colorrgba255 255 2555
12px14em arial ms5
open sanssans-serif color7170705
iframe-webkit-full-screen min-heightauto important4
font-familyhelvetica neue helveticaneuew01-55roma4
helvetica arial sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter4
helvetica arial sans-serifdisplaynone4
255 1 style-jmga8at2menucontainer4
color373737font-familyhelvetica neue helveticaneuew01-55roma4
255 255 09font-size0margin-top5px4
width100height100backgroundrgba255 255 2554
ease 0s background-color4
transitioncolor 04s ease4
74 1 0px4
background-color 04s ease4
0s background-color 04s4
transitionborder-color 04s ease4
rgba0 0 04
border-width2pxborder-colorrgba204 204 2044
255 1 ddm1navcontainer4
0 0 064
1bordersolid rgba74 743
normal normal 12px14em3
ms pgothicdotumhelveticasans-serif colorffffff3
rgba255 255 2553
positionfixed importantleftauto importantz-index503
style-jmga8at2item background-colorrgba255 2553
normal 12px14em arial3
980px 0529
calc100 980px29
margin-left calc10029
normal normal29
255 25523
ease 0s18
04s ease18
0 015
arial ms15
ms pgothicdotumhelveticasans-serif15
255 115
font normal11
74 7410
1background-colorrgba255 2559
helvetica arial8
helveticaneuew10-55roma helvetica8
border-width2px border-stylesolidborder-colorrgba2498
border-stylesolidborder-colorrgba249 2498
249 2498
249 1background-colorrgba2558
helveticaneuew02-55roma helveticaneuew10-55roma8
helveticaneuew01-55roma helveticaneuew02-55roma8
fontnormal normal8
neue helveticaneuew01-55roma8
204 2048
rgba74 748
margin0line-heightnormalletter-spacingnormal txtnew7
normal 14px14em6
74 16
1 0px6
14px14em arial6
12px14em arial5
open sanssans-serif5
sanssans-serif color7170705
1 style-jmga8at2menucontainer5
background-colorrgba255 2555
1 ddm1navcontainer5
width100height100backgroundrgba255 2554
255 09font-size0margin-top5px4
color373737font-familyhelvetica neue4
font-familyhelvetica neue4
arial sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter4
iframe positionabsolutewidth100height100overflowhidden4
arial sans-serifdisplaynone4
style-jmga8at2item border-radius04
solid transparent4
style-jmga8at2submenu style-jmga8at2item4
iframe-webkit-full-screen min-heightauto4
min-heightauto important4
border-width2pxborder-colorrgba204 2044
28 364
rgba0 04
0 064
transitionborder-color 04s4
background-color 04s4
0s background-color4
txtnew ul4
transitioncolor 04s4
style-jmga8at2item background-colorrgba2553
importantleftauto importantz-index503
rgba255 2553
selectdata-previewerror style-jmga8at2menucontainerarrow3
style-jmga8at2menucontainerarrow style-jmga8at2menucontainersvgcontainer3
ultxtnew ol3
positionfixed importantleftauto3
168 1683
ddm1navcontainerarrow ddm1navcontainersvgcontainer3
pgothicdotumhelveticasans-serif colorffffff3
selectdata-previewerror ddm1navcontainerarrow3
ol ul3
color ffffff3
1bordersolid rgba743
normal 12px14em3
background-color ffffff3
normal49
047
background-color40
color36
136
234
980px29
0529
calc10029
margin-left29
arial23
320
style-jmga8at2item19
04s18
ease18
0s18
txtnew18
416
516
pgothicdotumhelveticasans-serif15
solid15
style-jmga8at2menucontainer15
ms15
style-jmga8at2submenu15
important14
ddm1navcontainer13
positionabsolutetop0right0bottom0left012
displaynone12
font11
ddm1navcontainerarrow11
ul11
style-jmga8at2menucontainerarrow11
1px9
1background-colorrgba2559
helveticaneuew02-55roma8
fontnormal8
border-stylesolidborder-colorrgba2498
helveticaneuew01-55roma8
rgba748
helvetica8
positionabsolutetop0left0color373737width100height1008
helveticaneuew10-55roma8
neue8
border-width2px8
ol7
margin0line-heightnormalletter-spacingnormal7
0px7
var7
border-radius07
selectdata-previewfocus6
ddm1navcontainerarrowddm1navcontainerleft-direction6
color7170706
14px14em6
ffffff6
selectdata-errortrue6
66
style-jmga8at2menucontainerarrowstyle-jmga8at2menucontainerleft-direction6
style-jmga8at2menucontainerarrowstyle-jmga8at2menucontainerright-direction6
76
selecthover6
style-jmga8at2menucontainerarrowstyle-jmga8at2menucontainercenter-direction6
ddm1navcontainerarrowddm1navcontainerright-direction6
border06
selectfocus6
ddm1navcontainerarrowddm1navcontainercenter-direction6
selectdata-previewhover6
selectdata-previewerror6
ultxtnew5
width100height1005
iframe5
12px14em5
065
colorffffff5
sanssans-serif5
if5
background-colorrgba2555
overflowhidden5
open5
displayinline-block4
color373737font-familyhelvetica4
09font-size0margin-top5px4
width100height100backgroundrgba2554
color0099fftext-decorationunderlinecursorpointer4
min-heightauto4
sans-seriffont-size14pxdisplayinline-blockvertical-alignmiddlewidth100margin-top10pxtext-aligncenter4
font-familyhelvetica4
positionabsolutewidth100height100overflowhidden4
sans-serifdisplaynone4
color4a4a4a4
style-jmga8at2itemhoverarealast-child4
opacity14
0000004
iframe-webkit-full-screen4
b4labelwrapper4
84
94
104
border-width2pxborder-colorrgba2044
lb1itemscontainer4
select4
rgba04
style-jmga8at2label4
b4label4
114
b3labelwrapper4
124
transitionborder-color4
b0b0b04
b3label4
transitioncolor4
1bordersolid4
134
transparent4
ddm1repeaterbuttonlabel4
nbsp3
style-jmga8at2submenubefore3
style-jmga8at2menucontainersvgcontainer3
style-jmga8at2menucontainerleft-direction3
style-jmga8at2menucontainerright-direction3
style-jmga8at2menucontainercenter-direction3
fc3bg3
style-jmga8at2itemhoverareafirst-child3
cursorpointer3
1border-radius03
ddm1navcontainersvgcontainer3
ddm1navcontainerleft-direction3
border-right03
ddm1navcontainerright-direction3
border-left03
ddm1navcontainercenter-direction3
ddm1repeaterbuttondata-statedrop3
positionfixed3
oldirrtl3
importantleftauto3
importantz-index503
topautobottom03
rgba2553
left10pxright10px3
style-joeobb5obg3
b3link3
b4link3
rod3

Who hosts Mma-russia.ru?

Mma-russia.ru Hosting Provider Information

Hosted IP Address:81.177.135.12
Hosted Hostname:srv138-h-st.jino.ru
Service Provider:OJSC RTComm.RU
Hosted Country:RussiaRU
Location Latitude:55.7527
Location Longitude:37.6172
Webserver Software:Pepyaka/1.19.0

Is "OJSC RTComm.RU" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%
OJSC RTComm.RU
0.0558%

HTTP Header Analysis for Mma-russia.ru

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Sat, 24 Oct 2020 12:03:06 GMT
Content-Length: 0
Connection: keep-alive
location: https://www.rodmma.com/
x-wix-request-id: 1603540986.364436522873113809
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=euw2
Cache-Control: no-cache
Expires: -1
X-Seen-By: sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVh7cUgf0uw3g/ZEfNsCjwZK,2d58ifebGbosy5xc FRaloPX4ngKfQM8fEHbwELHijlanriluuFcI/J33aTkDtMoH2yWikl2EP5bJKtoyukhjw==,Nlv1KFVtIvAfa3AK9dRsI2R49qvlQaellnLNQ1U5qZKbpeoPBxy7lii6zmufEAr0,2UNV7KOq4oGjA5 PKsX47HMD3XjoxaKbTYcffYmebS0=,qquldgcFrj2n046g4RNSVPYxV603IO64T3vEIZzS9F0=,l7Ey5khejq81S7sxGe5Nk1mNIVXtftIA8h/TmHdungaTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,L03sCOqL64aOETEHHyNoxRek0OIgIozzxr9NR gUQAoK t7QwhJzwQ0zAZaDoPqC
Server: Pepyaka/1.19.0

Mma-russia.ru Domain Nameserver Information

HostIP AddressCountry
ns1.jino.ru 217.107.34.200
ns2.jino.ru 217.107.217.16


Need to find out who hosts Mma-russia.ru?


Domain Registration (WhoIs) information for Mma-russia.ru

 % By submitting a query to RIPN's Whois Service
% you agree to abide by the following terms of use:
% http://www.ripn.net/about/servpol.html#3.2 (in Russian)
% http://www.ripn.net/about/en/servpol.html#3.2 (in English).

domain: MMA-RUSSIA.RU
nserver: ns1.jino.ru.
nserver: ns2.jino.ru.
state: REGISTERED, DELEGATED, VERIFIED
person: Private Person
registrar: RU-CENTER-RU
admin-contact: https://www.nic.ru/whois
created: 2010-03-14T21:00:00Z
paid-till: 2021-03-14T21:00:00Z
free-date: 2021-04-15
source: TCI

Last updated on 2020-04-10T19:56:32Z

Websites with Similar Names

Mma-referee.academy
MMA REFEREE ACADEMY – "serve & protect"
Mma-russia.ru
Р.О.Д.Ъ. - Клуб смешанных единоборств

Recently Updated Websites

Fudget.com 2 seconds ago.Investir-bf.info 2 seconds ago.Abnnewswire.com 5 seconds ago.Texasnewsstudio.net 5 seconds ago.Kirklandhealthinstitute.com 5 seconds ago.Armorfreight.com 6 seconds ago.Tinarowden.com 6 seconds ago.Kosherkonnectiononline.com 7 seconds ago.Aircon-bird.com 8 seconds ago.Clickday.club 9 seconds ago.Trlvyou.com 11 seconds ago.N5telecom.com.br 12 seconds ago.Merchantsbankofindiana.com 15 seconds ago.Usopenkarate.com 16 seconds ago.Nxczz.com 18 seconds ago.Qmz.in 18 seconds ago.Infotiva.net 20 seconds ago.Potentialrec.com 23 seconds ago.Nutrelisagro.com 25 seconds ago.Abw188.me 26 seconds ago.Thamizhchelvan.com 27 seconds ago.Nathalieflubacher.ch 28 seconds ago.Candyapplekids.com 29 seconds ago.Larc.com 31 seconds ago.Apoorvelectricals.com 31 seconds ago.Heritagehatchingandhens.com.au 31 seconds ago.Wholesalesg.com 33 seconds ago.Eiffelturm.net 33 seconds ago.Aplusenerji.net 34 seconds ago.Mosmanglassprinters.com 35 seconds ago.