Mmc-beratung.info

Website Thumbnail
Checking...
multimedia connect Beratung | Smarthome Loxone Goldpartner

Safety: Low trust score
Year Founded: 2016
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-20
Category: This site has not been categorized yet

Professionelle Beratung/ Planung von Smarthome - Wohnraumkino - Multiroom AV Technik. Programmierung ihrer Loxone Anlage. Workshop zu innovativen Kabelstrukturen rund um das Bauvorhaben. Perfekte Systemintegration von Audio/Video Multimedia Anbindung


Domain summary

Domain label
mmc-beratung
Domain extension
info
Domain registered:
2016-02-17
Domain updated:
2020-10-20
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is mmc-beratung.info ranked relative to other sites:

Percentage of visits to mmc-beratung.info from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Mmc-beratung.info registered?
A: Mmc-beratung.info was registered 4 years, 9 months, 1 week, 4 days, 4 hours, 55 minutes, 15 seconds ago on Wednesday, February 17, 2016.
Q: When was the WHOIS for Mmc-beratung.info last updated?
A: The WHOIS entry was last updated 1 month, 1 week, 1 day, 4 hours, 55 minutes, 15 seconds ago on Tuesday, October 20, 2020.
Q: What are Mmc-beratung.info's nameservers?
A: DNS for Mmc-beratung.info is provided by the following nameservers:
  • shades05.rzone.de
  • docks09.rzone.de
Q: Who is the registrar for the Mmc-beratung.info domain?
A: The domain has been registered at Afilias Global Registry Services.
Q: What is the traffic rank for Mmc-beratung.info?
A: Mmc-beratung.info has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Mmc-beratung.info each day?
A: Mmc-beratung.info receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Mmc-beratung.info resolve to?
A: Mmc-beratung.info resolves to the IPv4 address 81.169.145.95.
Q: In what country are Mmc-beratung.info servers located in?
A: Mmc-beratung.info has servers located in the Germany.
Q: What webserver software does Mmc-beratung.info use?
A: Mmc-beratung.info is powered by Apache/2.4.43 (Unix) webserver.
Q: Who hosts Mmc-beratung.info?
A: Mmc-beratung.info is hosted by STRATO AG in Land Berlin, Berlin, Germany, 12529.
Q: How much is Mmc-beratung.info worth?
A: Mmc-beratung.info has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Mmc-beratung.info Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Mmc-beratung.info Free SEO Report

Website Inpage Analysis for Mmc-beratung.info

Keyword Cloud for Mmc-beratung.info

helveticaneuew0255roma helveticaneuew1055romaconnect beratung smarthomepositionfixed importantleftautoconnect beratungselecthoverphoneuri19bb7779894f4dc7bf25ee90c4cad7abjpgdescriptionpublic491df47b59584dc7902937f428755d45c2a37dfc36cf4bfdb94055bac7bdc9e6width4896height3264altartistidnameopacity04colorcolor14aligntypecenterfittingtypefillscrolltypeparallaxcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12izmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitlemobilehelveticaneuew0255roma helveticaneuew1055roma helveticaselectdatapreviewerror stylejruildx1navcontainerarrowstylejruildaklabelwrappercolor 000000normal boldloxone in klnzu innovativen kabelstrukturenselectdataerrortrueplanung von smarthomeinnovativen kabelstrukturenborderradius0rund umboldloxone goldpartnerpageuriseommcberatunghidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1vzmmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitlemobilebauvorhaben perfekte systemintegrationvon smarthome wohnraumkinoneue helveticaneuew0155roma helveticaneuew0255romainnovativensmarthomesystemintegration von audiovideostylejruildx1navcontainerrightdirectionstylejruildx1navcontaineranlagedisplaynoneaudiovideo multimedia anbindungmetakeywordsseoloxoneimportantleftauto importantzindex50av technik programmierungborderwidth2px borderstylesolidbordercolorrgba249 249selectdatapreviewfocusgoldpartnerpagetitleseomultimedia connecthelveticaneuew1055romagoldpartnerpageuriseommcberatunghidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1vzmmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitlemobile249 1backgroundcolorrgba0programmierung ihrer loxonefontnormal normalstylejruildx1navcontainerarrowstylejruildx1navcontainerleftdirectionnormal 700backgroundcolor 000000smarthome loxone goldpartnerpageuriseommcberatunghidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1vzmmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitlemobilehelveticaneuew1055roma helvetica arialmultiroom avworkshopstylejruildx1navcontainerarrowstylejruildx1navcontainerrightdirectionpositionstaticboxshadow000 0 01backgroundcolorrgba0von audiovideogoldpartnerpageuriseommcberatunghidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1vzmmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitlemobile phoneuri19bb7779894f4dc7bf25ee90c4cad7abjpgdescriptionpublic491df47b59584dc7902937f428755d45c2a37dfc36cf4bfdb94055bac7bdc9e6width4896height3264altartistidnameopacity04colorcolor14aligntypecenterfittingtypefillscrolltypeparallaxcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12izmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitlemobileloxone anlagemarginleft calc100arialwohnraumkino multiroom avoldirrtlcalc100 980pxdinnextw01lightdinnextw02lightdinnextw10lightsansserif color000000ulcalc100helveticaneuew0155roma helveticaneuew0255roma helveticaneuew1055romahelveticaneuew0155roma helveticaneuew0255romaimportantzindex50kln2stylejruildx1navcontainerleftdirectionprogrammierunganbindungmetakeywordsseoloxone goldpartnerpagetitleseomultimedia connectultxtnew ol04s ease 0sfontmultimedia anbindungmetakeywordsseoloxonelb1itemscontainerzu innovativenihrer loxone anlageneuefff200das bauvorhaben perfekte1backgroundcolorrgba0 0das bauvorhaben0 0 1ol ul204 204positionabsolutetop0right0bottom0left0perfekte systemintegrationbackgroundcoloravgoldpartnerpagetitleseomultimedia7zuberatung smarthome166 710srundinnovativen kabelstrukturen rundpositionfixed6dinnextw01lightdinnextw02lightdinnextw10lightsansseriffontnormal249 249 1backgroundcolorrgba0if1smarthome loxone980pxoverflowhiddenaudiovideoperfekte systemintegration vonneue helveticaneuew0155romaanlage workshop zumultimedia anbindungmetakeywordsseoloxone goldpartnerpagetitleseomultimediasmarthome wohnraumkinoprogrammierung ihrerworkshop zu innovativenav techniktechnikborderstylesolidbordercolorrgba249 249stylejruildx1repeaterbuttonlabelmargin0lineheightnormalletterspacingnormal05ffffffwohnraumkinoanlage workshopnormalborderwidth2px borderstylesolidbordercolorrgba249margin0lineheightnormalletterspacingnormal txtnewkabelstrukturenberatungnormal normal normal3pxpositionabsolutetop0left0color373737width100height100calc100 980px 05strc1inlinecontentbauvorhabendasplanung vonsystemintegration vongoldpartnerpagetitleseomultimedia connect beratungtechnik programmierung ihrerbauvorhaben perfektewohnraumkino multiroomihrerpositionstaticboxshadow000anbindungmetakeywordsseoloxonevon smarthomeloxone anlage workshopfont normal normalhelvetica arialimportantleftautostylejruildaklink3selectdatapreviewerrorcolorfont normalhelveticaneuew0155romaberatung smarthome loxone0technik programmierungvon4helveticaneuew0255romastylejruildx1navcontainercenterdirectiontxtnew ulnormal normal bold0 0980px 05stylejruildx1navcontainerarrowstylejruildx1navcontainercenterdirectioneasevon audiovideo multimedialoxone goldpartnerpageuriseommcberatunghidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1vzmmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitlemobile phoneuri19bb7779894f4dc7bf25ee90c4cad7abjpgdescriptionpublic491df47b59584dc7902937f428755d45c2a37dfc36cf4bfdb94055bac7bdc9e6width4896height3264altartistidnameopacity04colorcolor14aligntypecenterfittingtypefillscrolltypeparallaxcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12izmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitlemobileplanungum das bauvorhabenborderstylesolidbordercolorrgba249txtnewnormal normalhelveticaum1 stylejruildx1navcontainerhelveticaneuew1055roma helveticaperfekteimportantbackgroundcolor ffffffanbindungmetakeywordsseoloxone goldpartnerpagetitleseomultimediaberatung loxoneselectdatapreviewhoverborderwidth2pxvarol1backgroundcolorrgba0 0 0borderstylesolidbordercolorrgba249 249 249selectfocusberatung planungmultiroomum dasultxtnewpositionstaticboxshadow000 0loxonetopautobottom0255 255systemintegrationkabelstrukturen rund umaudiovideo multimedia000000stylejruildx1navcontainersvgcontainerstylejruildaklabelpositionfixed importantleftauto importantzindex50marginleft calc100 980px249 2490 1 stylejruildx1navcontainersmarthome wohnraumkino multiroom0 1americantypwrteritcw01731025americantypwrteritcw02737091serifmultimediastrc1dataresponsive249 1backgroundcolorrgba0 0multiroom av technikberatung planung voncolor0000005marginleftcolor ffffffstylejruildx1navcontainerarrowworkshop zuconnectease 0srund um das04s ease04skabelstrukturen rundstylejruildx1navcontainerarrow stylejruildx1navcontainersvgcontainerihrer loxone

Longtail Keyword Density for Mmc-beratung.info

KeywordsOccurences
calc100 980px 0522
margin-left calc100 980px22
font normal normal11
innovativen kabelstrukturen rund9
programmierung ihrer loxone9
ihrer loxone anlage9
loxone anlage workshop9
anlage workshop zu9
workshop zu innovativen9
zu innovativen kabelstrukturen9
kabelstrukturen rund um9
multiroom av technik9
rund um das9
um das bauvorhaben9
das bauvorhaben perfekte9
bauvorhaben perfekte systemintegration9
perfekte systemintegration von9
systemintegration von audiovideo9
von audiovideo multimedia9
connect beratung smarthome9
beratung smarthome loxone9
technik programmierung ihrer9
av technik programmierung9
wohnraumkino multiroom av9
smarthome wohnraumkino multiroom9
von smarthome wohnraumkino9
planung von smarthome9
beratung planung von9
04s ease 0s8
loxone goldpartnerpageuriseommc-beratunghidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1vzmmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitlemobile phoneuri19bb7779894f4dc7bf25ee90c4cad7abjpgdescriptionpublic491df47b-5958-4dc7-9029-37f428755d45c2a37dfc-36cf-4bfd-b940-55bac7bdc9e6width4896height3264altartistidnameopacity04colorcolor14aligntypecenterfittingtypefillscrolltypeparallaxcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12izmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitlemobile7
smarthome loxone goldpartnerpageuriseommc-beratunghidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1vzmmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitlemobile7
goldpartnerpagetitleseomultimedia connect beratung7
anbindungmetakeywordsseoloxone goldpartnerpagetitleseomultimedia connect7
multimedia anbindungmetakeywordsseoloxone goldpartnerpagetitleseomultimedia7
audiovideo multimedia anbindungmetakeywordsseoloxone7
normal normal bold6
0 0 15
normal normal normal5
0 1 style-jruildx1navcontainer4
1background-colorrgba0 0 04
249 1background-colorrgba0 04
249 249 1background-colorrgba04
border-stylesolidborder-colorrgba249 249 2494
neue helveticaneuew01-55roma helveticaneuew02-55roma4
helveticaneuew01-55roma helveticaneuew02-55roma helveticaneuew10-55roma4
border-width2px border-stylesolidborder-colorrgba249 2494
helveticaneuew02-55roma helveticaneuew10-55roma helvetica4
helveticaneuew10-55roma helvetica arial4
positionstaticbox-shadow000 0 03
positionfixed importantleftauto importantz-index503
loxone in kln3
980px 0522
margin-left calc10022
calc100 980px22
normal normal17
0 012
font normal11
zu innovativen9
smarthome wohnraumkino9
perfekte systemintegration9
um das9
rund um9
kabelstrukturen rund9
innovativen kabelstrukturen9
beratung planung9
planung von9
von smarthome9
wohnraumkino multiroom9
workshop zu9
multiroom av9
av technik9
systemintegration von9
technik programmierung9
programmierung ihrer9
ihrer loxone9
loxone anlage9
anlage workshop9
bauvorhaben perfekte9
das bauvorhaben9
von audiovideo9
04s ease9
smarthome loxone9
connect beratung9
beratung smarthome9
audiovideo multimedia9
ease 0s8
margin0line-heightnormalletter-spacingnormal txtnew7
multimedia anbindungmetakeywordsseoloxone7
anbindungmetakeywordsseoloxone goldpartnerpagetitleseomultimedia7
goldpartnerpageuriseommc-beratunghidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1vzmmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitlemobile phoneuri19bb7779894f4dc7bf25ee90c4cad7abjpgdescriptionpublic491df47b-5958-4dc7-9029-37f428755d45c2a37dfc-36cf-4bfd-b940-55bac7bdc9e6width4896height3264altartistidnameopacity04colorcolor14aligntypecenterfittingtypefillscrolltypeparallaxcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12izmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitlemobile7
goldpartnerpagetitleseomultimedia connect7
loxone goldpartnerpageuriseommc-beratunghidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1vzmmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitlemobile7
normal bold6
0 16
1 style-jruildx1navcontainer5
background-color ffffff5
color ffffff5
txtnew ul4
204 2044
helveticaneuew10-55roma helvetica4
1background-colorrgba0 04
249 1background-colorrgba04
249 2494
border-stylesolidborder-colorrgba249 2494
border-width2px border-stylesolidborder-colorrgba2494
neue helveticaneuew01-55roma4
helveticaneuew01-55roma helveticaneuew02-55roma4
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif color0000004
helvetica arial4
helveticaneuew02-55roma helveticaneuew10-55roma4
166 713
255 2553
ol ul3
ultxtnew ol3
importantleftauto importantz-index503
positionfixed importantleftauto3
positionstaticbox-shadow000 03
selectdata-previewerror style-jruildx1navcontainerarrow3
style-jruildx1navcontainerarrow style-jruildx1navcontainersvgcontainer3
normal 7003
fontnormal normal3
background-color 0000003
color 0000003
beratung loxone3
background-color38
color36
normal32
029
calc10022
loxone22
beratung22
margin-left22
0522
980px22
positionabsolutetop0right0bottom0left019
txtnew18
smarthome18
von18
connect15
style-jruildx1navcontainer13
font11
style-jruildx1navcontainerarrow11
multiroom10
ffffff10
ul10
multimedia10
110
wohnraumkino9
anlage9
ease9
planung9
04s9
technik9
important9
programmierung9
ihrer9
av9
innovativen9
workshop9
das9
zu9
systemintegration9
perfekte9
bauvorhaben9
displaynone9
audiovideo9
um9
rund9
kabelstrukturen9
28
0s8
38
phoneuri19bb7779894f4dc7bf25ee90c4cad7abjpgdescriptionpublic491df47b-5958-4dc7-9029-37f428755d45c2a37dfc-36cf-4bfd-b940-55bac7bdc9e6width4896height3264altartistidnameopacity04colorcolor14aligntypecenterfittingtypefillscrolltypeparallaxcoloroverlaycoloroverlayopacity0ispresettruemobilecustomtruereftypebackgroundmediaidcustombgimg12izmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagemobilemediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitlemobile7
color0000007
din-next-w01-lightdin-next-w02-lightdin-next-w10-lightsans-serif7
margin0line-heightnormalletter-spacingnormal7
goldpartnerpageuriseommc-beratunghidepagefalseismobilelandingpagefalseunderconstructionfalsetpaapplicationid0pagesecurityrequireloginfalseispopupfalseindexabletrueislandingpagefalsepagebackgroundsdesktopcustomtruereftypebackgroundmediaidcustombgimg1vzmmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsemediareftypeimageidmainpagedesktopmediarefmetadatapageidmainpageispresetfalseschemaversion20ishiddenfalsetitlemobile7
ol7
goldpartnerpagetitleseomultimedia7
anbindungmetakeywordsseoloxone7
var7
0000006
style-jruildx1navcontainerarrowstyle-jruildx1navcontainerright-direction6
style-jruildx1navcontainerarrowstyle-jruildx1navcontainercenter-direction6
overflowhidden6
style-jruildx1navcontainerarrowstyle-jruildx1navcontainerleft-direction6
46
bold6
ultxtnew5
if5
helveticaneuew10-55roma4
helveticaneuew01-55roma4
lb1itemscontainer4
style-jruildx1repeaterbuttonlabel4
positionabsolutetop0left0color373737width100height1004
neue4
helveticaneuew02-55roma4
1background-colorrgba04
border-stylesolidborder-colorrgba2494
border-width2px4
fff2004
americantypwrteritcw01--731025americantypwrteritcw02--737091serif4
style-jruildaklabelwrapper4
arial4
helvetica4
selectdata-previewhover3
selectfocus3
border-radius03
selecthover3
style-jruildx1navcontainerleft-direction3
style-jruildx1navcontainersvgcontainer3
53
fontnormal3
selectdata-errortrue3
selectdata-previewfocus3
positionstaticbox-shadow0003
selectdata-previewerror3
style-jruildx1navcontainerright-direction3
style-jruildx1navcontainercenter-direction3
positionfixed3
importantleftauto3
importantz-index503
topautobottom03
oldirrtl3
strc1inlinecontent3
strc1data-responsive3
63
73
3px3
style-jruildaklabel3
style-jruildaklink3
kln3

Who hosts Mmc-beratung.info?

Mmc-beratung.info Hosting Provider Information

Hosted IP Address:81.169.145.95
Hosted Hostname:w8f.rzone.de
Service Provider:STRATO AG
Hosted Country:GermanyDE
Location Latitude:52.5174
Location Longitude:13.3985
Webserver Software:Apache/2.4.43 (Unix)

Is "STRATO AG" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%
STRATO AG
0.3803%

HTTP Header Analysis for Mmc-beratung.info

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Tue, 20 Oct 2020 15:03:44 GMT
Server: Apache/2.4.43 (Unix)
Location: https://www.multimedia-connect.de/
Content-Length: 242
Content-Type: text/html; charset=iso-8859-1

Mmc-beratung.info Domain Nameserver Information

HostIP AddressCountry
shades05.rzone.de 85.214.0.235
docks09.rzone.de 81.169.146.19


Need to find out who hosts Mmc-beratung.info?


Domain Registration (WhoIs) information for Mmc-beratung.info

 Domain Name: MMC-BERATUNG.INFO
Registry Domain ID: D503300000005436736-LRMS
Registrar WHOIS Server:
Registrar URL: http://www.cronon.org
Updated Date: 2020-02-17T22:34:45Z
Creation Date: 2016-02-17T18:28:08Z
Registry Expiry Date: 2021-02-17T18:28:08Z
Registrar Registration Expiration Date:
Registrar: Cronon AG
Registrar IANA ID: 141
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone:
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registrant Organization:
Registrant State/Province:
Registrant Country: DE
Name Server: SHADES05.RZONE.DE
Name Server: DOCKS09.RZONE.DE
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form is https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2020-08-18T09:27:06Z

Websites with Similar Names

Mmc-beratung.com
multimedia connect Beratung | Smarthome Loxone Goldpartner
Mmc-beratung.info
multimedia connect Beratung | Smarthome Loxone Goldpartner

Recently Updated Websites

Pilamoon.ir 2 seconds ago.Blockchain9.com 3 seconds ago.Designshutters.com 4 seconds ago.Aloharicevimenti.it 6 seconds ago.Gaziantepyayinlari.com.tr 6 seconds ago.Last3rhinos.com 7 seconds ago.Ninamua.com 7 seconds ago.Tunus.com 9 seconds ago.Fifthfreedommodels.com 9 seconds ago.Sandragaillambert.com 10 seconds ago.Gamblingdeals.in 12 seconds ago.Pierluigicarofano.it 14 seconds ago.Customize.shoes 14 seconds ago.Hackromtools.info 15 seconds ago.Noga.gov.bh 15 seconds ago.Zmcr.us 16 seconds ago.Kengoodwindds.com 17 seconds ago.Pet-book.ch 18 seconds ago.23dlq.com 20 seconds ago.Staet.cn 23 seconds ago.Pavanahotel.com 26 seconds ago.Daeyunshin.com 27 seconds ago.Oma365.de 28 seconds ago.Championsitting.com 31 seconds ago.Nesall.org 32 seconds ago.Anhuiymcf.cn 34 seconds ago.Hewittandwhitty.com.au 34 seconds ago.Yazhii.net 35 seconds ago.Sfxeghr.tk 36 seconds ago.Milparosa.com 38 seconds ago.