Momfluential Media - The Original Influential

Safety: Low trust score
Year Founded: 2009
Global Traffic Rank: 943,813
Estimated Worth: $1,680
Last updated:2020-10-14
Category: This site has not been categorized yet

Moms are the original influential. Mom approved family travel, recipes, crafts, and product reviews.


Domain summary

Domain label
momfluential
Domain extension
net
Domain registered:
2009-11-09
Domain updated:
2020-10-10
Global Traffic Rank
943,813
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$1,680
Estimated daily income
$7
Estimated monthly income
$213

Rank summary

How is momfluential.net ranked relative to other sites:

Percentage of visits to momfluential.net from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Momfluential.net registered?
A: Momfluential.net was registered 11 years, 3 months, 3 weeks, 1 day, 9 hours, 49 minutes, 23 seconds ago on Monday, November 9, 2009.
Q: When was the WHOIS for Momfluential.net last updated?
A: The WHOIS entry was last updated 4 months, 3 weeks, 1 day, 9 hours, 49 minutes, 23 seconds ago on Saturday, October 10, 2020.
Q: What are Momfluential.net's nameservers?
A: DNS for Momfluential.net is provided by the following nameservers:
  • dns1.ph102.peopleshostshared.com
  • dns2.ph102.peopleshostshared.com
Q: Who is the registrar for the Momfluential.net domain?
A: The domain has been registered at eNom, LLC.
Q: What is the traffic rank for Momfluential.net?
A: Momfluential.net ranks 943,813 globally on Alexa. Momfluential.net has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Momfluential.net each day?
A: Momfluential.net receives approximately 1,082 visitors and 2,164 page impressions per day.
Q: What IP address does Momfluential.net resolve to?
A: Momfluential.net resolves to the IPv4 address 144.208.108.7.
Q: In what country are Momfluential.net servers located in?
A: Momfluential.net has servers located in the United States.
Q: What webserver software does Momfluential.net use?
A: Momfluential.net is powered by Apache webserver.
Q: Who hosts Momfluential.net?
A: Momfluential.net is hosted by NephoScale Inc. in United States.
Q: How much is Momfluential.net worth?
A: Momfluential.net has an estimated worth of $1,680. An average daily income of approximately $7, which is roughly $213 per month.

Momfluential.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Momfluential.net Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Momfluential.net

H1 Headings

1 :
  1. Momfluential Media

H2 Headings

21 :
  1. Yes on Prop 22 Because It’s Good for Our Community
  2. Arcade Style Fun at Home with ProjeX
  3. Super Easy & Comfy 10 Minute Pocket Style Headband Mask
  4. How Well Does Your DIY Mask Really Work?
  5. Animal Crossing New Horizons makes Social Distancing More Bearable
  6. Celebrating National Brothers and Sisters Day
  7. DIY Face Mask with Blue Shop Towel Filter
  8. Trumpentaschen – The Best Hamantaschen Ever
  9. Clever Music Teacher Guitar Pick Holiday Gift
  10. Simple Plans: How To Make An Oil Menorah
  11. DIY Decoupage Disney Marvel Menorah
  12. Ridiculous, Hideous and Revolting AF – Our Hanukkah Sweater Round Up
  13. Lights, Candles, Hanukkah Blessings! Everything You Need to Know to Make and Light a Menorah
  14. Best Mint Lip Gloss Chapstick and Balms for the Whole Family
  15. Grateful Heart Thanksgiving Pinwheel Cookies
  16. This Thanksgiving Pass The Gratitude Jar
  17. Keto Buffet Choices for Keto Travelers on Vacation at Beaches Turks and Caicos
  18. The Bosch Dishwasher That Dries Everything
  19. Hotel Irvine Expertly Mixes Business and Pleasure
  20. Scouting Out Orange County Instagram Locations on a So Cal Staycation
  21. This Family Whale Watching Trip to Baja was Life Changing, in all the Best Ways

H3 Headings

0 :

H4 Headings

1 :
  1. Let’s Go Shopping

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

26 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-24736459-1

Links - Internal

71:

Links - Outbound (nofollow)

5:

Keyword Cloud for Momfluential.net

hotelsupervarraquoyearlikecardsbecausediyto8230 read moremakingoilmade0it8217smeamtrumpentaschenalltheseul licrossinggift cardsbutmyffffffanimal crossingffffff importantsimplesocialicons2 ulread more raquohanukkah sweaterussimplebeenhanukkahnew horizonsworkmakesi8217veimportantifshopthanksgivingread moredotheyanimal crossing newmint lipfunnotjustdishwasher that drieshasmorewebestcan8217thomesimplesocialicons2dishwashercookiesall opinionsyourlipfavoritereadsweateranimaldisney marvelknowalsostylestillholidaypinwheelfinallyli afocusdisneymarvel menorahmenorahsul li afocusmaskshorizonsdriestraveluporangenowtakecanonicalsimplesocialicons2 ul licrossing new horizonsmintownulquarantinehaveopinionscrossing newafocuscamemenorahmaskmakefamilynewmore raquoketosometo8230 readsoourgiftlioutto8230thingyoumarveldon8217t

Longtail Keyword Density for Momfluential.net

KeywordsOccurences
read more raquo21
simple-social-icons-2 ul li6
animal crossing new3
crossing new horizons3
to8230 read more3
dishwasher that dries3
ul li afocus3
read more21
more raquo21
simple-social-icons-2 ul6
ul li6
all opinions4
animal crossing3
crossing new3
new horizons3
gift cards3
to8230 read3
disney marvel3
marvel menorah3
hanukkah sweater3
mint lip3
li afocus3
ffffff important3
more25
raquo21
read21
my15
you13
we11
hanukkah10
all10
best8
08
have8
masks8
diy8
important7
var7
holiday6
family6
out6
year6
so6
simple-social-icons-26
ul6
li6
our6
home6
marvel5
these5
thanksgiving5
up5
style5
now5
menorah5
canonical5
us5
it8217s5
work5
make5
some5
came4
cookies4
i8217ve4
made4
oil4
they4
menorahs4
lip4
me4
keto4
dishwasher4
hotel4
ffffff4
opinions4
like4
travel4
but4
new4
your4
mask4
not4
can8217t4
mint3
animal3
know3
pinwheel3
take3
simple3
if3
dries3
sweater3
am3
making3
afocus3
finally3
because3
just3
do3
also3
quarantine3
been3
shop3
own3
still3
trumpentaschen3
don8217t3
thing3
orange3
super3
has3
gift3
cards3
makes3
favorite3
to82303
horizons3
fun3
crossing3
disney3

Who hosts Momfluential.net?

Momfluential.net Hosting Provider Information

Hosted IP Address:144.208.108.7
Hosted Hostname:stats.ph102.peopleshostshared.com
Service Provider:NephoScale Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Apache

Is "NephoScale Inc." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
NephoScale Inc.
0.0203%

HTTP Header Analysis for Momfluential.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Wed, 14 Oct 2020 18:23:18 GMT
Server: Apache
Referrer-Policy: unsafe-url
x-frame-options: SAMEORIGIN
X-Content-Type-Options: nosniff
Link:; rel="https://api.w.org/"
Content-Encoding: gzip
Vary: Accept-Encoding,User-Agent
X-XSS-Protection: 1; mode=block
Strict-Transport-Security: max-age=31536000; includeSubdomains;
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Momfluential.net Domain Nameserver Information

HostIP AddressCountry
dns1.ph102.peopleshostshared.com 144.208.108.6United States United States
dns2.ph102.peopleshostshared.com 144.208.108.7United States United States


Need to find out who hosts Momfluential.net?


Domain Registration (WhoIs) information for Momfluential.net

 Domain Name: momfluential.net
Registry Domain ID: 1575135754_DOMAIN_NET-VRSN
Registrar WHOIS Server: WHOIS.ENOM.COM
Registrar URL: WWW.ENOM.COM
Updated Date: 2019-10-30T23:54:55.00Z
Creation Date: 2009-11-09T19:34:00.00Z
Registrar Registration Expiration Date: 2020-11-09T19:34:00.00Z
Registrar: ENOM, INC.
Registrar IANA ID: 48
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited
Registrant Name: REDACTED FOR PRIVACY
Registrant Organization: REDACTED FOR PRIVACY
Registrant Street: REDACTED FOR PRIVACY
Registrant Street:
Registrant City: REDACTED FOR PRIVACY
Registrant State/Province: CA
Registrant Postal Code: REDACTED FOR PRIVACY
Registrant Country: US
Registrant Phone: REDACTED FOR PRIVACY
Registrant Phone Ext:
Registrant Fax: REDACTED FOR PRIVACY
Registrant Email: https://tieredaccess.com/contact/d24ff608-1852-454b-b723-c0eed63194a8
Admin Name: REDACTED FOR PRIVACY
Admin Organization: REDACTED FOR PRIVACY
Admin Street: REDACTED FOR PRIVACY
Admin Street:
Admin City: REDACTED FOR PRIVACY
Admin State/Province: REDACTED FOR PRIVACY
Admin Postal Code: REDACTED FOR PRIVACY
Admin Country: REDACTED FOR PRIVACY
Admin Phone: REDACTED FOR PRIVACY
Admin Phone Ext:
Admin Fax: REDACTED FOR PRIVACY
Admin Email: REDACTED FOR PRIVACY
Tech Name: REDACTED FOR PRIVACY
Tech Organization: REDACTED FOR PRIVACY
Tech Street: REDACTED FOR PRIVACY
Tech Street:
Tech City: REDACTED FOR PRIVACY
Tech State/Province: REDACTED FOR PRIVACY
Tech Postal Code: REDACTED FOR PRIVACY
Tech Country: REDACTED FOR PRIVACY
Tech Phone: REDACTED FOR PRIVACY
Tech Phone Ext:
Tech Fax: REDACTED FOR PRIVACY
Tech Email: REDACTED FOR PRIVACY
Name Server: DNS1.PH102.PEOPLESHOSTSHARED.COM
Name Server: DNS2.PH102.PEOPLESHOSTSHARED.COM
DNSSEC: unsigned
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.4259744689
URL of the ICANN WHOIS Data Problem Reporting System: HTTP://WDPRS.INTERNIC.NET/
>>> Last update of WHOIS database: 2020-08-11T12:37:36.00Z

Websites with Similar Names

Momflex.com
HOME | Mysite 2
Momflirt.com
MomsFlirt.com - Moms Flirt, Flirt with Hot Moms - MomsFlirt
Momflo.com
momflo.com -&nbspmomflo Resources and Information.
Momfluence.com
momfluence.co
Momfluential.net
Momfluential Media - The Original Influential

Recently Updated Websites

Wheretoeatinkilleen.com (1 second ago.)Imminentsoft.com (4 seconds ago.)Ileannebuigas.info (4 seconds ago.)4384o.com (7 seconds ago.)Tubebeysumundo.com (7 seconds ago.)Tugusujonuxy.gq (7 seconds ago.)Timonu.com (7 seconds ago.)Route5me.com (8 seconds ago.)Astrologiaparacuriosos.com (10 seconds ago.)Oliandhalo.com (10 seconds ago.)Davidhardy.us (11 seconds ago.)Vaahinis.com (13 seconds ago.)Komunitassepedaponorogo.com (13 seconds ago.)Spotcheckservices.net (15 seconds ago.)Rocktheplanetent.com (16 seconds ago.)Chaturbaie.com (16 seconds ago.)Stopthestatusquo.com (16 seconds ago.)Correlog.info (17 seconds ago.)Deligthfuljewelry.com (18 seconds ago.)Golfneom.com (19 seconds ago.)Neomustaqbal.com (20 seconds ago.)66729.xyz (21 seconds ago.)Terrazasdelmonte.com (21 seconds ago.)Fromthehipts.com (22 seconds ago.)Brooklinevillagecleaners.com (22 seconds ago.)Bitcoin-hardware-wallet.com (24 seconds ago.)Fasterbetting.com (26 seconds ago.)590bb.com (26 seconds ago.)Butchtea.com (27 seconds ago.)Cryptopark.org (27 seconds ago.)

Recently Searched Keywords

1 -1 (9 seconds ago.)rcps.loyale.us.central maine (11 seconds ago.)preferences backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11promotitle (14 seconds ago.)fiery_redhead (15 seconds ago.)7x7 wigunited (23 seconds ago.)0try (32 seconds ago.)consultancy bedrijven (48 seconds ago.)0s 1 (59 seconds ago.)vn c th (1 minute 1 second ago.)vn anh (1 minute 4 seconds ago.)fat-teen-porn (1 minute 5 seconds ago.)vit nam tin (1 minute 6 seconds ago.)vit nam t (1 minute 8 seconds ago.)introducing the ion torrent genexus system learn more › (1 minute 12 seconds ago.)amazonプライム会員とは? (1 minute 12 seconds ago.)0928 (1 minute 26 seconds ago.)vit nam mua (1 minute 35 seconds ago.)vin giao hng (1 minute 37 seconds ago.)vin giao (1 minute 39 seconds ago.)ls17 update (1 minute 43 seconds ago.)356hk (1 minute 44 seconds ago.)vi mc gi (1 minute 49 seconds ago.)big cash download (1 minute 50 seconds ago.)0900 (1 minute 52 seconds ago.)viruses amp (1 minute 53 seconds ago.)_k_______ (1 minute 54 seconds ago.)ecom- aic (1 minute 56 seconds ago.)cá kho làng vũ đại thương hiệu dasavina đạt danh hiệu vàng – món ngon tinh hoa ẩm thực việt 2014 (2 minutes 4 seconds ago.)vi mc (2 minutes 5 seconds ago.)nikolaus knebel oman (2 minutes 6 seconds ago.)