«MONDAY RUN» – как начать бегать и пробежать марафон

Safety: High trust score
Year Founded: 2020
Global Traffic Rank: 964,234
Estimated Worth: $9
Last updated:2020-12-03
Category: Sports > Running

«MONDAY RUN» ➜ от первой пробежки до марафона. Обзоры гаджетов ⌚ для бега, новинок и классики. Собственный опыт и поиск истины в научных исследованиях.


Domain summary

Domain label
mondayrun
Domain extension
com.ua
Global Traffic Rank
964,234
Statvoo Rating
H
Trust Score
High trust score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is mondayrun.com.ua ranked relative to other sites:

Percentage of visits to mondayrun.com.ua from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Mondayrun.com.ua registered?
A: Mondayrun.com.ua was registered 1 month, 2 weeks, 6 days, 1 hour, 47 minutes, 6 seconds ago on Thursday, December 3, 2020.
Q: When was the WHOIS for Mondayrun.com.ua last updated?
A: The WHOIS entry was last updated 1 month, 2 weeks, 6 days, 1 hour, 47 minutes, 6 seconds ago on Thursday, December 3, 2020.
Q: What are Mondayrun.com.ua's nameservers?
A: DNS for Mondayrun.com.ua is provided by the following nameservers:
  • ariadne.ns.cloudflare.com
  • nile.ns.cloudflare.com
Q: Who is the registrar for the Mondayrun.com.ua domain?
A: The domain has been registered at .
Q: What is the traffic rank for Mondayrun.com.ua?
A: Mondayrun.com.ua ranks 964,234 globally on Alexa. Mondayrun.com.ua has a High trust score, and a Statvoo Rank of H.
Q: How many people visit Mondayrun.com.ua each day?
A: Mondayrun.com.ua receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Mondayrun.com.ua resolve to?
A: Mondayrun.com.ua resolves to the IPv4 address 104.24.115.126.
Q: In what country are Mondayrun.com.ua servers located in?
A: Mondayrun.com.ua has servers located in the United States.
Q: What webserver software does Mondayrun.com.ua use?
A: Mondayrun.com.ua is powered by CloudFlare webserver.
Q: Who hosts Mondayrun.com.ua?
A: Mondayrun.com.ua is hosted by CloudFlare, Inc. in United States.
Q: How much is Mondayrun.com.ua worth?
A: Mondayrun.com.ua has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Mondayrun.com.ua Reviews

We have 1 review(s) for Mondayrun.com.ua

Add your review
Verified Ukraine

 (3 weeks ago)
 

"Running as an adventure"


Personal blog about running and near topics: reviews, ratings and articles about running.

Mondayrun.com.ua Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Mondayrun.com.ua

H1 Headings

1 :
  1. MONDAY RUN ❤️

H2 Headings

12 :
  1. В чём бегать зимой: Гайд по Зимней Одежде для Бега
  2. Почему Бег по Пульсу не Всегда Эффективен?
  3. Обзор Polar Grit X и 99 километров пробежек
  4. Мой ТОП каналов о беге на YouTube (обновляется)
  5. Что такое Nike Vaporfly и зачем в беговых кроссовках карбоновая пластина?
  6. 7 приложений для бега, проверенных на личном опыте
  7. Лучшие Кроссовки для Бега по Асфальту 2020
  8. Обзор Polar Vantage M и 96 километров пробежек
  9. Как я Бежал на Chornohora Sky Marathon 2020
  10. Действительно ли эффективен бег для похудения?
  11. Навигация по записям
  12. Подписаться на обновления блога MONDAY RUN ❤️

H3 Headings

3 :
  1. Часы Polar для бега: преимущества и недостатки
  2. Профессиональная бегунья Дарья Михайлова о Первом Марафоне, Кении и London Marathon 2020
  3. Как выбрать куртку для бега?

H4 Headings

6 :
  1. Топ гаджетов
  2. Партнёр обзоров Monday RUN:
  3. Обо мне
  4. Подборки Беговых Кроссовок
  5. Поможет при выборе:
  6. Последние комментарии:

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

28 :

Google Adsense

:
pub-2166747972462693

Google Analytics

:
Not Applicable

Links - Internal

56:

Links - Internal (nofollow)

0:

Links - Outbound

55:

Keyword Cloud for Mondayrun.com.ua

reviewstatisticsdivaffiliatebutton ahoverbackground 8dc153wpprtemplate2 wpprreviewoptionratingffce55ffce55 wpprtemplate1span colorwpprdefaultrunahovervantage m50c1e9wpprc100wpprnotbad50c1e9 wpprtemplate1spancolor 50c1e9documentwritewpprtemplate1wpprreviewgradeoptionwpprreviewrating3baedareviewwrapup reviewwurightreviewwugrade wpprc100wpprweakreviewstatistics reviewwubarsreviewwugrade wpprc100wpprverygoodmonday run1commentmetagrade backgroundwpprbar bordercolorwpprgoodvalidatorformatff7f66wpprfill8dc1532wpprbarspan reviewgradewidgetwpprtemplate1 wpprreviewstarscolorlicolored background2020 danwpprreviewoptionratingmarathon 2020reviewgradewidget wpprc100wpprverygoodwpprc100wpprverygoodreviewwurightwpprc100wpprgoodreviewwugradewpprtemplate2 wpprreviewratingcolor 8dc153wpprreviewstarsyourlondonreviewstatistics reviewwrapup reviewwurightbackground ffce55ff7f66 wpprtemplate18dc153 reviewstatisticsreviewgradewidget wpprc100wpprweakcolor ff7f66reviewwubarse1e2e0wpprbar reviewgradewidgetreviewgradewidget wpprc100wpprgoodbordercolorvantagewpprnotbadreviewgradewidget wpprc100wpprnotbadsolidreviewgradewidgetwpprverygoodvalidatorformat 0background ff7f66licoloredbackgroundlondon marathonwpprtemplate2gritreviewwugrade wpprc100wpprnotbadreviewwugrade wpprc100wpprgoodpolarpolar vantagewpprtemplate1 wpprreviewgradeoptiondansolid 3baedadivaffiliatebuttoncommentmetagrademonday0marathonhellipfacebooktwittergooglepinterestlinkedinpolar vantage mpolar gritxusercommentsgradescolor ffce55wpprtemplatewpprweakreviewwrapupwpprfill reviewwugradegrit xreviewstatistics reviewwrapup3baeda divaffiliatebuttonbackground 50c1e9polar grit x8dc153 wpprtemplate1wpprtemplate1 wpprreviewgradenumberwpprfill reviewgradewidgetwpprc100wpprweakwpprreviewgradenumberm

Longtail Keyword Density for Mondayrun.com.ua

KeywordsOccurences
polar grit x3
polar vantage m3
review-statistics review-wrap-up review-wu-right3
validatorformat 06
review-statistics review-wu-bars6
span color6
background ffce555
background 50c1e95
color 8dc1535
background 8dc1535
monday run5
background ff7f665
review-statistics review-wrap-up5
wppr-template-1 wppr-review-grade-option5
wppr-template-2 wppr-review-rating5
wppr-template-1 wppr-review-grade-number5
wppr-template-1 wppr-review-stars5
licolored background4
3baeda divaffiliate-button4
color ffce554
wppr-template-2 wppr-review-option-rating4
comment-meta-grade background4
wppr-fill review-wu-grade4
marathon 20204
wppr-bar border-color4
span review-grade-widget4
wppr-bar review-grade-widget4
wppr-fill review-grade-widget4
review-wrap-up review-wu-right3
review-wu-grade wppr-c100wppr-not-bad3
2020 dan3
polar grit3
grit x3
ff7f66 wppr-template-13
ffce55 wppr-template-13
50c1e9 wppr-template-13
8dc153 wppr-template-13
divaffiliate-button ahover3
polar vantage3
solid 3baeda3
london marathon3
vantage m3
review-wu-grade wppr-c100wppr-weak3
review-grade-widget wppr-c100wppr-not-bad3
8dc153 review-statistics3
review-grade-widget wppr-c100wppr-weak3
color ff7f663
review-grade-widget wppr-c100wppr-very-good3
review-wu-grade wppr-c100wppr-very-good3
color 50c1e93
review-grade-widget wppr-c100wppr-good3
review-wu-grade wppr-c100wppr-good3
background24
color23
wppr-template-119
review-wu-grade13
wppr-template-213
dan13
review-grade-widget13
review-statistics12
polar11
8dc15311
span11
hellipfacebooktwittergooglepinterestlinkedin10
ffce5510
50c1e99
ff7f669
wppr-fill8
wppr-bar8
08
17
review-wu-bars7
wppr-c100wppr-good6
wppr-c100wppr-very-good6
divaffiliate-button6
monday6
wppr-c100wppr-not-bad6
documentwrite6
wppr-c100wppr-weak6
validatorformat6
marathon5
wppr-review-option-rating5
wppr-review-stars5
wppr-review-grade-number5
wppr-default5
wppr-weak5
wppr-not-bad5
wppr-good5
wppr-review-rating5
wppr-very-good5
wppr-review-grade-option5
user-comments-grades5
3baeda5
run5
review-wrap-up5
e1e2e04
border-color4
licolored4
comment-meta-grade4
m3
wppr-template3
your3
grit3
vantage3
x3
solid3
london3
ahover3
23
review-wu-right3

Who hosts Mondayrun.com.ua?

Mondayrun.com.ua Hosting Provider Information

Hosted IP Address:104.24.115.126
Hosted Hostname:104.24.115.126
Service Provider:CloudFlare, Inc.
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:CloudFlare

Is "CloudFlare, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
CloudFlare, Inc.
0.9929%

HTTP Header Analysis for Mondayrun.com.ua

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 03 Dec 2020 03:49:51 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Expires: Wed, 11 Jan 1984 05:00:00 GMT
Cache-Control: no-cache, must-revalidate, max-age=0
Pragma: no-cache
X-Powered-By: PHP/7.2.27
Link:; rel=shortlink
Vary: Accept-Encoding
CF-Cache-Status: DYNAMIC
cf-request-id: 06c8518b790000070a00917000000001
Expect-CT: max-age=604800, report-uri="https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct"
Report-To: {"endpoints":[{"url":"https:\/\/a.nel.cloudflare.com\/report?s=PHrmaXH6jERalaPYvxSw7nmYqMNGXO9uO28a+Z+Cl4fEhFMwC4kEk4EK/C+8Eq+kpCFKnieSDAzQFlcL2bX9xWdcpqP1+B2tyvazBW6eqf7W"}],"group":"cf-nel","max_age":604800}
NEL: {"report_to":"cf-nel","max_age":604800}
Server: cloudflare
CF-RAY: 5fba51f25c1e070a-LHR
Content-Encoding: gzip

Mondayrun.com.ua Domain Nameserver Information

HostIP AddressCountry
ariadne.ns.cloudflare.com 162.159.38.225
nile.ns.cloudflare.com 172.64.33.214


Need to find out who hosts Mondayrun.com.ua?


Domain Registration (WhoIs) information for Mondayrun.com.ua

 % Request from 18.132.13.38
% This is the Ukrainian Whois query server #A.
% The Whois is subject to Terms of use
% See https://hostmaster.ua/services/
%
% IN THE PROCESS OF DELEGATION OF A DOMAIN NAME,
% THE REGISTRANT IS AN ENTITY WHO USES AND MANAGES A CERTAIN DOMAIN NAME,
% AND THE REGISTRAR IS A BUSINESS ENTITY THAT PROVIDES THE REGISTRANT
% WITH THE SERVICES NECESSARY FOR THE TECHNICAL MAINTENANCE OF THE REGISTRATION AND OPERATION OF THE DOMAIN NAME.
% FOR INFORMATION ABOUT THE REGISTRANT OF THE DOMAIN NAME, YOU SHOULD CONTACT THE REGISTRAR.

domain: mondayrun.com.ua
dom-public: NO
mnt-by: ua.imena
nserver: ariadne.ns.cloudflare.com
nserver: nile.ns.cloudflare.com
status: clientTransferProhibited
created: 2019-07-07 01:10:30+03
modified: 2020-06-10 19:16:05+03
expires: 2021-07-07 01:10:30+03
source: UAEPP

% Registrar:
%
% The following disclaimer was provided by the domain name registrar
% ==========
% Предоставленная информация является неполной и может содержать ошибки,
% связанные с особенностями механизмов кеширования информации,
% несинхронного обновления реестров и т.п., поэтому не является достоверной и
% предоставляется исключительно в ознакомительных целях. В связи с вышеуказанным,
% данная информация не может быть использована в целях разрешения споров, конфликтов,
% определения имущественных и неимущественных прав и т.п.
% Единственным источником первичных данных о доменном имени является регистратор (registrar)
% доменного имени, который может предоставить необходимую информацию по запросу,
% в установленном законом порядке.
%
% The provided information is incomplete and may contain errors related to the specificity
% of information caching mechanisms, asynchronous updating of registries, etc.,
% therefore it is not reliable and is provided for informational purposes only.
% In connection with the above, this information can not be used to resolve disputes,
% conflicts, determine property and non-property rights, etc.
% The only source of primary data about the domain name is the registrar of the domain name,
% which can provide the required information upon request, in accordance with the procedure established by law.
% ==========
registrar: ua.imena
organization: Internet Invest Ltd
organization-loc: ТОВ "Інтернет Інвест"
url: http://www.imena.ua
city: Kyiv
country: UA
abuse-email: Login to show email
+380442010102
abuse-postal: Ukraine 01033 Kyiv Gaydara str., h 50 B, 2d floor
abuse-postal-loc: Україна 01033 Київ вул. Гайдара, 50 Б, 2 пов
source: UAEPP

% Registrant:
% ===========
person: Registrant information is not published
person-loc: Інформація про реєстранта не публікується
organization: Whois privacy protection service
organization-loc: Захист персональних даних
e-mail: not published
address: not published
address-loc: not published
phone: not published
fax: not published
mnt-by: ua.imena
status: ok
status: linked
created: 2013-04-08 22:19:45+03
modified: 2015-11-18 10:57:28+02
source: UAEPP

% Administrative Contacts:
% =======================
person: Registrant information is not published
person-loc: Інформація про реєстранта не публікується
organization: Whois privacy protection service
organization-loc: Захист персональних даних
e-mail: not published
address: not published
address-loc: not published
phone: not published
fax: not published
mnt-by: ua.imena
status: ok
status: linked
created: 2013-04-08 22:19:45+03
modified: 2015-11-18 10:57:28+02
source: UAEPP

% Technical Contacts:
% ===================
person: Registrant information is not published
person-loc: Інформація про реєстранта не публікується
organization: Whois privacy protection service
organization-loc: Захист персональних даних
e-mail: not published
address: not published
address-loc: not published
phone: not published
fax: not published
mnt-by: ua.imena
status: ok
status: linked
created: 2013-04-08 22:19:45+03
modified: 2015-11-18 10:57:28+02
source: UAEPP


% Query time: 13 msec

Websites with Similar Names

Monda.cc
盟大集团——全心全意服务于产业价值链
Monda.com
Welding protection supplies - Monda
Monda.no
Mondå Forlag – Illustrating Cultures
Mondabooks.com
Mondå Forlag – Illustrating Cultures
Mondacacarpas.com
Alquiler de carpas Sevilla y Huelva | Mondaca Carpas
Mondacei.com
403 Forbidden
Mondaches.com
Mondaches.com

Recently Updated Websites

Montfortmassagetherapybykathia.net (3 seconds ago.)Groshers.net (3 seconds ago.)Judi303.org (4 seconds ago.)Lytekgear.net (4 seconds ago.)Apositiveperspective.org (5 seconds ago.)Sugarwater.shop (6 seconds ago.)Disputeresolutioncoaching.net (6 seconds ago.)Vallas.net (7 seconds ago.)Mokroe1.net (7 seconds ago.)Rukitostore.net (8 seconds ago.)Ladyrogue.net (9 seconds ago.)Evengalia.net (9 seconds ago.)Reikionlinecertification.org (9 seconds ago.)Lewisworldblogs.org (11 seconds ago.)Stophatingyourcountry.org (11 seconds ago.)Wealthupdates10at22776.monster (11 seconds ago.)Ekmentoring.net (12 seconds ago.)Mosefy.net (12 seconds ago.)Eddyvisco.org (12 seconds ago.)Yourcomputerdesks.online (12 seconds ago.)Theamericaninspiration.org (13 seconds ago.)Foreverobjects.shop (14 seconds ago.)Koolapp.net (15 seconds ago.)Jacobbarrera.net (15 seconds ago.)Medicatedsoap.net (16 seconds ago.)Meganpickeringinclusivearts.show (16 seconds ago.)Contrarianinvesting.org (16 seconds ago.)Goodgirlfitness.net (17 seconds ago.)Altyapivesporokullari.org (18 seconds ago.)Femalerealestateinvestors.org (18 seconds ago.)

Recently Searched Keywords

0px 000000 box-shadow (2 seconds ago.)cá kho bá kiến có quy trình chế biến được kiểm tra nghiêm ngặt theo 1 hệ thống nhất định của dasavina (4 seconds ago.)us who we (15 seconds ago.)σύνθεση σαλονιού porto (18 seconds ago.)missouribotanicalgarden (19 seconds ago.)multiplayer online (19 seconds ago.)cdnvanila (20 seconds ago.)ǰ�߷籩�����ƽ�� (21 seconds ago.)kyiv (22 seconds ago.)bogdan mustiata (23 seconds ago.)500 sale (25 seconds ago.)want to know more (27 seconds ago.)iparent app (28 seconds ago.)w o (30 seconds ago.)style-jt0g3yldnavcontainerarrowstyle-jt0g3yldnavcontainerleft-direction (33 seconds ago.)var dnew (34 seconds ago.)coinmama (34 seconds ago.)81 (36 seconds ago.)progressive jackpots (37 seconds ago.)mua my (39 seconds ago.)cá kho bá kiến có quy trình chế biến được kiểm tra nghiêm ngặt theo 1 hệ thống nhất định của dasavina (39 seconds ago.)encoding (41 seconds ago.)8:44 شرموطة بتدلع كسها الجميل وتولعه (42 seconds ago.)toughened nitrite (44 seconds ago.)забор из профнастила цена киев (46 seconds ago.)graphicsumbrella (50 seconds ago.)crock (53 seconds ago.)uumlruumlnler (54 seconds ago.)cá kho bá kiến có quy trình chế biến được kiểm tra nghiêm ngặt theo 1 hệ thống nhất định của dasavina (1 minute 1 second ago.)pecans (1 minute 3 seconds ago.)