Moser-reisen.ch  |  Home, Carreisen, Rundreisen, Tagesfahrten– Moser Reisen
Low trust score  | 
Einsteigen, geniessen, erleben mit Moser Reisen. Carreisen, Badeferien, Musikreisen, Städtefahrten, Ferienwochen, Hochzeitsfahrten, Kurzfahrten...

Moser-reisen.ch Website Information

Moser-reisen.ch has a Low Trust Score, a Statvoo Rank of I, an Alexa Rank of 0, a Majestic Rank of 0, a Domain Authority of 0% and is not listed in DMOZ.

Moser-reisen.ch is hosted by Cyon GmbH in Switzerland.
Moser-reisen.ch has an IP Address of 194.126.200.49 and a hostname of server39.cyon.ch.

The domain moser-reisen.ch was registered 201 decades 8 years 9 months ago by SWITCH Domain Name Registration, it was last modified 201 decades 8 years 9 months ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for moser-reisen.ch

Full Whois Lookup for Moser-reisen.ch Whois Lookup

The number of requests per client per time interval is
restricted. You have exceeded this limit.
Please wait a moment and try again.

Who hosts Moser-reisen.ch?

Moser-reisen.ch Web Server Information

Hosted IP Address:194.126.200.49
Hosted Hostname:server39.cyon.ch
Service Provider:Cyon GmbH
Hosted Country:SwitzerlandCH
Location Latitude:47
Location Longitude:8
Webserver Software:unknown

HTTP Header Analysis for Moser-reisen.ch

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
X-Powered-By: PHP/5.5.31
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Content-Encoding: gzip
Vary: Accept-Encoding
Date: Thu, 14 Jan 2016 02:01:03 GMT
Accept-Ranges: bytes
Connection: close


Need to find out who hosts Moser-reisen.ch?

Moser-reisen.ch Free SEO Report

Website Inpage Analysis for Moser-reisen.ch

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Moser-reisen.ch

0 6pxfontfamilyhelveticaarialsansserifwidthautofontsize14pxmargin0 padding0inputinputtypecheckboxfield tableboxshadow 0 0typecaptchamargin10px0 20pxborderbottom1px solidfontsize13pxformsie31pxboxshadow 0solidwircolorfffdisplayblock margin0inputtypetextwebkitboxshadow 0telefoncursorpointer6px 000labelborderbottom1px0 20px 012pxtypedate option4px052ungltigebackgroundnonefield20pxpromoformtypb6b6b6 formnamefontsize12pxreisenmargin0widthoverflowhiddenfontsize15px formimportant2052 305 33fontweightboldb6b6b6 form typecaptchaform typecaptcha6px promoformtyp0 0importantsolid b6b6b6noticefontsize11pxpositionrelative6pxselecttypeinput31px 31pxsubmitbittetopfontsize15pxpositionabsolutetextaligncentertyperadio2pxlineheight20pxwidth100form typedate optionform typeradio option052 305border1px solid b6b6b60 0 6px10px0 rgba00008datum305 33buttonmobylines1fontweightnormaloptionalle0 0margin0 0form field tabledioption inputtypebuttonform typeradiofield labelpromoformtyp formcheckboxpadding40promoformtyp submitform typedateb6b6b6inputtypebuttonformcheckboxichmosertabletypeinput option0 0 20pxsolid b6b6b6 formbackgroundimagenone4px 10pxfontstylenormal20px 0inputtypetext floatleftwebkitboxshadow 0 0000border1pxform typeinputfield optionfloatleftform fieldborder1px solidpadding2pxrgba0000830 6px 000form typeinput optionrighttyperadio optionboxshadow0importantwidth70pxpadding0form noticeform field labeltypedatewebkitboxshadowform field optionwidth110px20px 0 rgba00008displayblock

Longtail Keyword Density for Moser-reisen.ch

KeywordsOccurences
form field option7
form typeinput option7
0 0 6px6
0 6px 0006
border1px solid b6b6b65
form field table5
solid b6b6b6 form5
0 20px 04
20px 0 rgba000084
box-shadow 0 04
-webkit-box-shadow 0 04
form typedate option4
0 0 20px4
052 305 333
form typeradio option3
b6b6b6 form typecaptcha3
form field label3
form field21
0 020
border1px solid9
form typeinput7
field option7
typeinput option7
solid b6b6b67
0 6px6
promoformtyp submit6
6px 0006
form typecaptcha5
field table5
margin0 05
b6b6b6 form5
0 20px4
0 rgba000084
box-shadow 04
20px 04
6px promoformtyp4
-webkit-box-shadow 04
31px 31px4
margin0 padding04
4px 10px4
form typeradio4
typedate option4
option inputtypebutton4
form typedate4
promoformtyp formcheckbox4
305 333
052 3053
inputtypetext floatleft3
displayblock margin03
field label3
font-size15px form3
typeradio option3
form notice3
0 0important3
border-bottom1px solid3
056
form50
promoformtyp38
option22
field21
6px20
solid16
margin012
padding010
colorfff9
border1px9
input7
typeinput7
cursorpointer7
10px7
floatleft7
b6b6b67
table7
positionrelative7
widthauto6
label6
positionabsolute6
submit6
font-size14px6
2px6
padding6
0006
31px6
inputtypetext6
4px6
typecaptcha5
important5
15
font-weightbold5
font-size15px5
text-aligncenter4
formcheckbox4
-webkit-box-shadow4
right4
rgba000084
20px4
top4
width110px4
box-shadow4
select4
di4
12px4
sie4
typeradio4
inputtypebutton4
background-imagenone4
font-weightnormal4
width4
typedate4
moser3
ungltige3
wir3
reisen3
0523
23
33
font-familyhelveticaarialsans-serif3
inputtypecheckbox3
displayblock3
font-size13px3
width70px3
0important3
overflowhidden3
font-stylenormal3
alle3
43
backgroundnone3
width1003
notice3
margin10px3
ich3
name3
telefon3
datum3
font-size12px3
padding2px3
font-size11px3
bitte3
line-height20px3
border-bottom1px3
buttonmobylines3

What are the nameservers for moser-reisen.ch?

Moser-reisen.ch Domain Nameserver Information

HostIP AddressCountry
ns1.cyon.ch 194.126.200.5Switzerland Switzerland
ns2.cyon.ch 91.206.24.2Switzerland Switzerland

Moser-reisen.ch Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Moser-reisen.ch is a scam?