Moshannon Valley School District / Homepage

Safety: Low trust score
Year Founded: 1998
Global Traffic Rank: Unknown
Estimated Worth: $9
Category: This site has not been categorized yet



Domain summary

Last updated
2020-10-17
Domain label
movalley
Domain extension
org
Domain registered:
1998-07-16
Domain updated:
2020-10-17
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Frequently Asked Questions (FAQ)

Q: When was Movalley.org registered?
A: Movalley.org was registered 23 years, 2 months, 4 days, 2 hours, 19 minutes, 16 seconds ago on Thursday, July 16, 1998.
Q: When was the WHOIS for Movalley.org last updated?
A: The WHOIS entry was last updated 11 months, 3 days, 2 hours, 19 minutes, 16 seconds ago on Saturday, October 17, 2020.
Q: What are Movalley.org's nameservers?
A: DNS for Movalley.org is provided by the following nameservers:
  • ns5.worldnic.com
  • ns6.worldnic.com
Q: Who is the registrar for the Movalley.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Movalley.org?
A: Movalley.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Movalley.org each day?
A: Movalley.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Movalley.org resolve to?
A: Movalley.org resolves to the IPv4 address 52.206.191.232.
Q: In what country are Movalley.org servers located in?
A: Movalley.org has servers located in the United States.
Q: What webserver software does Movalley.org use?
A: Movalley.org is powered by Awselb/2.0 webserver.
Q: Who hosts Movalley.org?
A: Movalley.org is hosted by AMAZON-AES in Virginia, Ashburn, United States, 20149.
Q: How much is Movalley.org worth?
A: Movalley.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Movalley.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Movalley.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Movalley.org

H1 Headings

5 :
  1. Moshannon Valley School District
  2. Announcements
  3. Live Sports
  4. Apply Now
  5. QuickLinks

H2 Headings

6 :
  1. Coronavirus Information
  2. Find It Fast
  3.  
  4. Stay Connected
  5. Visit Us
  6. Contact Us

H3 Headings

3 :
  1. School Operating Plans
  2. Moshannon Valley is pleased to be live-streaming all football, soccer, and volleyball games on the NFHS Network.  There is no charge to fans or visitors to watch MoValley events.  
  3. We appreciate your support of our Black Knight and Lady Damsel athletic programs and hope you enjoy watching our athletes!  

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

22 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-5173826-6

Links - Internal

118:

Links - Internal (nofollow)

0:

Links - Outbound

30:

Links - Outbound (nofollow)

0:

Keyword Cloud for Movalley.org

epreventdefault getuidialogoverlay uiswalert functionclicksublistattrariahidden trueattrariaexpanded falseoklength 0 alertboxidvarpmi flexdataid groupyearpmiviewtouse tagraisedbydatepickeruidialogoverlaybasemodal uidialogoverlay uiswalertoklengthpmi renderloc0fromrenderloc0tag tagrenderloc0fromrenderloc0enablequirksmode0tag tagswchanneldropdownhide thisremoveclasshover varnavs activeselectoridalertviewtouse hid miidpanav0swalertopen 1 ifepreventdefault get iddomainid 4loaddatacontainer miid1 ifflexdataid groupyear groupmonthschoolif swalertopen 1escape keyhidmiiddetailviewval getcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidelse if ekeycodeif alertboxid oklengthmiidfinduiwidgetdetailfinduiarticleappendnbspaattrhrefpagemoduleinstanceidopendomainidno ifsafetyhidden detail viewifactive class1 vargroupyear groupyeartaglistfunction loadtaggeddatacontainer miidenablequirksmode0viewid viewtouse7targetviewif dialogoverlaywindowlargemodalbodymoderatecontentlength 0flexdataid flexdataid groupyeardatagetcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid pagemoduleinstanceidakeypressfunctioneekeycodesublistattrariahiddenget id27 escapebodyonkeydown uidialogoverlaybasemodalwellnessviewtouse hidvar sublist thischildrenulakeypressfunctione ifewhichalertboxid okclick elseactiveselectorid aattrhrefdomainid 4 varfunction loaddatacontainer miidinformationloadtaggeddatacontainer miidremove focusifewhich 13 thisclickdocumentonmouseoutnoclick elseiftargetviewpageid 1var data varbus schedulestrcookiedialogoverlaywindowlargemodalbodymoderatecontentlengthnoclickgroupmonth groupby targetviewcontainer 2 chksidebarokclick else alertboxidreturnhomedoesntmodulecontent miidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunctionpmi renderloc0fromrenderloc0tagalertboxid noclickli akeypressfunctione ifewhichviewtouse looksfunction loaddatacontainerclose dialog uidialogoverlayclosemodalvisiblelastclickviewtouse ifhidmiidsidebarlistviewlength 0loadtaggeddatacontainersectionremovegroupby enablequirksmode0viewidsublisttrimsublisthtmlvar renderlocfunction loadgroupeddatacontainer miidfocusmoderated content doesntbuilder view varmodulecontent miidfinduiwidgetdetailfinduiarticleappendnbspplanuiswalertlength ifdetail viewtargetview hidmiiddetailviewval getcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid0 varpagethisremoveclasshover1 var renderlocthroughpmi groupyear groupmonthclassthisremoveclasshover vardialog uidialogoverlayclosemodalvisiblelastclickgroupby enablequirksmode0viewid viewtousecafeteriaaddedvar failure callcontrollerfailureresult0errormessagedialogoverlaywindowlargemodalbodymoderatecontentlength 0modulecontent miidinternetuiswalertlengththisremoveclasshover var sublistbleedalertboxid okclickviewtouse6groupmonth groupby taghidden sidebarraisedbydatepicker etargetclasslistcontainsdatepicker ifampmiid pmi groupyeare var swalertopentag tag containerenablequirksmode0viewidelse removeetargetblur etargetclasslistremovefocusswalertopen uiswalertlength ifmoderatedakeypressfunctione ifewhich 135selectschoolulheightdata successelse remove focusbuilder view targetview0 ifhiddenchksidebar settimeoutfunctionsetfocus etargetblur etargetclasslistremovefocusviewidheighttag enablequirksmode0viewidviewtouseuiswalertattrid clickloaddatacontainerfamiliesmiid pmi flexdataiduiswalertdialog if dialogoverlaywindowlargemodalbodymoderatecontentlengthalertboxid uiswalertattriddialog uidialogoverlayclosemodalvisiblelastclick elsealreadyflexdataidsidebareventactivechannelnavtyperenderloc0fromrenderloc0groupyear groupyearcheckepreventdefaultrenderloc 00 modulecontentenablequirksmode0viewidviewtousecheck if escuidialogoverlayclosemodalvisiblelastclick elsegroupbythisclick functiondocumentonclick2 chksidebargroupmonth groupbyfieldcontainerhid miid sidebarlistviewvalfunction e varelsealertboxid oklength 0202021idetargetblur etargetclasslistremovefocus documentreadyfunctionescapemiid pagemoduleinstanceidcheckscriptmoduleviewcheckscriptmustachebodyonkeydowntag iftargetviewpmi renderloc0fromrenderloc0groupyearmake sureremove focus etargetblurestopimmediatepropagation epreventdefaultrenderloc0fromrenderloc0tag tag enablequirksmode0viewidviewtousefalserenderloc0fromrenderloc0enablequirksmode0tag tag viewidestopimmediatepropagationfocus etargetbluractiveselectoridokallkey estopimmediatepropagation epreventdefaultdocumentreadyfunction var domainidlist viewpressed on datepickergroupby tagnoclick else ifchannelrenderloc 0 varfailurebuttonproplinkhrefsubsurechevroncontent doesnt bleedthisclicksuccess failurepmi tagchksidebar function13 thisclick functionchksidebar settimeoutfunction modulecontentviewtouse ifhidmiidsidebarlistviewlength1 if ekeycodeetargetclasslistcontainsdatepicker if4var viewtousedocumentonmouseovergroupmonth groupbyif alertboxidrenderloc0fromrenderloc0tagpmi flexdataidcommentshidsafety plannavigationpageid 1 varkey estopimmediatepropagationmake sure moderatedopenpagesubmenuthisparentifhidmiidsidebarlistviewlengthtrimsublisthtml sublistattrariahiddenetargetclasslistcontainsdatepickercheck iftag tagview var4 varchksidebarhidden sidebar listswalertopen 1ulswpgmenutoplevelremoveclassswpgmenuopenaddclassswpgmenuclosedvar successmiid findtabindexfirstfocus 2000 targetviewtargetview hidmiiddetailviewvalmoshannon valley schooldialogoverlaywindowlargemodalbodymoderatecontentlength 0 modulecontenttargetview containergradeundefined targetviewlengthnbspgroupbyfieldtag container 2eventkeycodeaddescmoshannon valleyflexdataid groupyearrenderloc0fromrenderloc0groupyear groupyear groupmonth2 chksidebar functionetargetclasslistremovefocushrefopen alertview targetview hidmiiddetailviewvaltag containercallcontrollerfailureresult0errormessagemakerenderloc0fromrenderloc0enablequirksmode0tagloadgroupeddatacontainergroupbyfield groupbyif eventkeycodeelse ifdetail view definedvar alertboxidetargetclasslistremovefocus documentreadyfunctionbuilderhidmiiddetailviewval getcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miidsuccesssitenavulheighteventdateidbleed throughif ekeycodemiid pagemoduleinstanceid pmirenderloc0fromrenderloc0groupyearalertboxid noclick elsecontentviewgroupmonth groupbyfield groupbyview definedealert var alertboxidalertboxid oklengthfunction ifepreventdefault checkvalley0 var miidmvknightsstudentswalertopensettimeoutfunction modulecontent13 thisclicktargetview container 2findtabindexfirstfocusif ekeycode 27oklength 0tag viewtouse looksview var viewtousetag iftargetview undefinedbus schedule 202021groupmonth groupmonth groupbyfieldvar sublistraisedbydatepicker etargetclasslistcontainsdatepicker4 var pageiddialog ifcontent doesntsidebar listvar miidpagemoduleinstanceid pmi flexdataidgetcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidetargetclasslistcontainsdatepicker if raisedbydatepickervar pageidifhidmiidsidebarlistviewlength 0 viewtousegroupmonth groupmonthpmi tag viewtousemiidalertboxid uiswalertattrid clicklidatabcsidepreventdefault check iftag enablequirksmode0viewidviewtouse containeruiswalert function edata success failuremoderated contentfunction egetschedule 202021educationloaddatacontainer miid pmipagemoduleinstanceid pmi renderloc0fromrenderloc0tagvar alertboxid uiswalertattriddocumentreadyfunction taglistif dialogoverlaywindowlargemodalbodymoderatecontentlengthcheck to makebuilder viewtargetview looksesc was pressedsublist thischildrenul0 targetview lookspressedepreventdefault closeif escopen alert varswalertopen uiswalertlengthdivswspecialmodebarmiidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunction checkscriptmoduleviewcheckscriptmustachevar swalertopenvar domainiddatepickermoshannonrenderlocclosegroupmonthclick okgroupyear groupmonth groupmonthgroupyear groupmonth groupbysublist thischildrenul ifpagemoduleinstanceid pmi renderloc0fromrenderloc0groupyeargroupby renderloc0fromrenderloc0enablequirksmode0taggroupyear groupmonthpagenavigationstatecookieenablequirksmode0viewidviewtouse container 2sidebarlistviewval getcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miidloadtaggeddatacontainer miid pmidatepicker varif raisedbydatepicker estopimmediatepropagationuidialogoverlayclosemodalvisiblelastclicktagsidebarlistviewval getcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidthisclick function loadgroupeddatacontainerflexdataid flexdataidekeycode 27 escapethischildrenul if trimsublisthtmlifhidmiidsidebarlistviewlength 0alert varnofamily lettergroupby targetviewfunctionloadgroupeddatacontainer miiduidialogoverlaytargetviewlength 0sure moderated1undefined0 viewtouselooksfamilydoesnt bleed2 chksidebar settimeoutfunctiondefinedli akeypressfunctionechksidebar function loaddatacontainerathleticdocumentreadyfunction taglist lidocumentreadyfunction checkscriptmoduleviewcheckscriptmustache0 modulecontent miidfinduiwidgetdetailfinduiarticleappendnbspvar renderloc 0iftargetview undefined targetviewlengthnavsif trimsublisthtmlestopimmediatepropagation epreventdefault getspecialuiswalertattrid click okpmi flexdataid flexdataidlistelse alertboxiddocumentreadyfunctionmiid sidebarlistviewval getcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceidtargetview tag iftargetviewourthischildrenulpageidactiveselectorid aattrtargetraisedbydatepicker estopimmediatepropagation epreventdefaultmiid sidebarlistviewvalfunction loadtaggeddatacontainerundefined targetviewlength 0enablequirksmode0viewid viewtouse taguserregidthrough the dialogfunction loadgroupeddatacontainerok or nomiid pmisure moderated contentif raisedbydatepicker0 alertboxidvar pageid 1sublistattrariahidden trueattrariaexpandedrenderloc0fromrenderloc0tag tag2lettervalley schoolmodulecontentestopimmediatepropagation epreventdefault checkswchanneldropdownhidepagemoduleinstanceid pmilicollapsibleeachfunctiontrueattrariaexpanded falsefindif trimsublisthtml sublistattrariahiddencomments 1swgotosearchresultspageswsearchinputestopimmediatepropagation epreventdefault closedata variftargetview undefinedvar viewtouse ifhidmiidsidebarlistviewlengthvar swalertopen uiswalertlengthvar raisedbydatepickeruluibreadcrumbshealthviewid targetview containerlist view definedvar failure3settimeoutfunction8var datatrueattrariaexpandedlihidden detailalertboxiddetailif swalertopensiteuidialogoverlaybasemodaltargetviewlengthpmi groupyearifewhich 13no if alertboxid0 viewtouse hidtargetview tagdata var successtag viewtouseadded to checkfindtabindexfirstfocus 2000 alertboxid okclickkeydoesnt bleed throughmodulecontent miid findtabindexfirstfocusuiswalertattridvar raisedbydatepicker etargetclasslistcontainsdatepickervar domainid 4swinnerwrapheightviewid targetviewusthischildrenul ifmiidfinduiwidgetdetailfinduiarticleappendnbsp documentreadyfunctionbodyonkeydown uidialogoverlaybasemodal uidialogoverlaydialoghid miidsettimeoutfunction modulecontent miidgroupbyfield groupby enablequirksmode0viewidtaglist li akeypressfunctionegroupyearescape key estopimmediatepropagationifewhichsidebar list viewscheduleuidialogoverlaybasemodal uidialogoverlayetargetblurdatepicker var raisedbydatepickerpmi renderloc0fromrenderloc0groupyear groupyearpagenavigationstatecookie functionuiswalert functionview targetviewclose dialogmiid findtabindexfirstfocusletter to familiesbushealth and safetyid of opengroupby tag viewtouseswchanneldropdownhide thisremoveclasshovertruee varmenus27 escape keyviewtouse tag tagdistrictfailure callcontrollerfailureresult0errormessagetrimsublisthtml sublistattrariahidden trueattrariaexpandedcontainer 2enablequirksmode0viewidviewtouse containersidebarlistviewvalokclick elsemiid pmi taggroupbyfield groupby renderloc0fromrenderloc0enablequirksmode0taguiswalertlength if swalertopenepreventdefault close dialograisedbydatepicker estopimmediatepropagationflexdataid groupyear groupyearelse alertboxid noclickuidialogoverlay uiswalertparentzindextaglist ligroupby targetview taggroupyear groupyear groupmonthaddoffcanvasmenuheightforsitenavdocumentreadyfunction varisedithidmiiddetailviewvalekeycode 27tag viewiduidialogoverlayclosemodalvisiblelastclick else removeactivechksidebar function loadtaggeddatacontainerzindexloadgroupeddatacontainer miid pmitargetviewlength 0 targetviewokclicktag viewid targetviewgetcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miidaattrtargetlidatabcsid activeselectoridgroupby renderloc0fromrenderloc0enablequirksmode0tag tag

Longtail Keyword Density for Movalley.org

KeywordsOccurences
if ekeycode 2720
key estopimmediatepropagation epreventdefault20
escape key estopimmediatepropagation20
27 escape key20
ekeycode 27 escape20
container 2 chksidebar15
getcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid pagemoduleinstanceid15
miid pagemoduleinstanceid pmi15
letter to families13
1 if ekeycode10
swalertopen 1 if10
list view defined10
if swalertopen 110
ui-sw-alertlength if swalertopen10
groupyear groupmonth groupby10
2 chksidebar function10
var swalertopen ui-sw-alertlength10
tag viewtouse looks10
hidden sidebar list10
sidebar list view10
swalertopen ui-sw-alertlength if10
builder view var10
e var swalertopen10
ui-dialog-overlay-base-modal ui-dialog-overlay ui-sw-alert10
ui-dialog-overlay ui-sw-alert function10
groupmonth groupbyfield groupby10
groupmonth groupmonth groupbyfield10
groupyear groupmonth groupmonth10
ui-sw-alert function e10
function e var10
-sidebarlistviewval getcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid10
estopimmediatepropagation epreventdefault get10
miid -sidebarlistviewval getcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid10
hid- miid -sidebarlistviewval10
viewtouse hid- miid10
0 viewtouse hid-10
ifhid-miid-sidebarlistviewlength 0 viewtouse10
viewtouse ifhid-miid-sidebarlistviewlength 010
var viewtouse ifhid-miid-sidebarlistviewlength10
view var viewtouse10
id of open10
epreventdefault get id10
raisedbydatepicker estopimmediatepropagation epreventdefault10
pressed on datepicker10
datepicker var raisedbydatepicker10
var raisedbydatepicker etargetclasslistcontainsdatepicker10
raisedbydatepicker etargetclasslistcontainsdatepicker if10
etargetclasslistcontainsdatepicker if raisedbydatepicker10
if raisedbydatepicker estopimmediatepropagation10
estopimmediatepropagation epreventdefault close10
check if esc10
epreventdefault close dialog10
close dialog ui-dialog-overlay-closemodalvisiblelastclick10
dialog ui-dialog-overlay-closemodalvisiblelastclick else10
ui-dialog-overlay-closemodalvisiblelastclick else remove10
else remove focus10
remove focus etargetblur10
focus etargetblur etargetclasslistremovefocus10
esc was pressed10
epreventdefault check if10
open alert var10
alertboxid oklength 010
alert var alertboxid10
var alertboxid ui-sw-alertattrid10
alertboxid ui-sw-alertattrid click10
ui-sw-alertattrid click ok10
ok or no10
no if alertboxid10
if alertboxid oklength10
oklength 0 alertboxid10
estopimmediatepropagation epreventdefault check10
0 alertboxid okclick10
alertboxid okclick else10
okclick else alertboxid10
else alertboxid noclick10
alertboxid noclick else10
noclick else if10
else if ekeycode10
bodyonkeydown ui-dialog-overlay-base-modal ui-dialog-overlay10
etargetblur etargetclasslistremovefocus documentreadyfunction9
module-content- miid findtabindexfirstfocus5
loadtaggeddatacontainer miid pmi5
groupyear groupyear groupmonth5
groupbyfield groupby renderloc0fromrenderloc0enablequirksmode0tag5
groupby renderloc0fromrenderloc0enablequirksmode0tag tag5
renderloc0fromrenderloc0enablequirksmode0tag tag viewid5
tag viewid targetview5
viewid targetview container5
targetview container 25
chksidebar function loadtaggeddatacontainer5
function loadtaggeddatacontainer miid5
miid pmi tag5
settimeoutfunction module-content- miid5
pmi tag viewtouse5
pagemoduleinstanceid pmi renderloc0fromrenderloc0tag5
pmi renderloc0fromrenderloc0tag tag5
renderloc0fromrenderloc0tag tag enablequirksmode0viewidviewtouse5
tag enablequirksmode0viewidviewtouse container5
enablequirksmode0viewidviewtouse container 25
2 chksidebar settimeoutfunction5
chksidebar settimeoutfunction module-content-5
flexdataid flexdataid groupyear5
miid findtabindexfirstfocus 2005
flexdataid groupyear groupyear5
tag iftargetview undefined5
pmi flexdataid flexdataid5
0 module-content- miidfindui-widget-detailfindui-articleappendnbsp5
content doesnt bleed5
doesnt bleed through5
through the dialog5
dialog if dialog-overlay-windowlargemodal-bodymoderatecontentlength5
if dialog-overlay-windowlargemodal-bodymoderatecontentlength 05
dialog-overlay-windowlargemodal-bodymoderatecontentlength 0 module-content-5
module-content- miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction5
sure moderated content5
miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction checkscriptmoduleviewcheckscriptmustache5
documentreadyfunction tag-list li5
tag-list li akeypressfunctione5
pagemoduleinstanceid pmi flexdataid5
akeypressfunctione ifewhich 135
ifewhich 13 thisclick5
moderated content doesnt5
make sure moderated5
thisclick function loadgroupeddatacontainer5
4 var pageid5
if trimsublisthtml sublistattraria-hidden5
trimsublisthtml sublistattraria-hidden trueattraria-expanded5
sublistattraria-hidden trueattraria-expanded false5
documentreadyfunction var domainid5
var domainid 45
domainid 4 var5
var pageid 15
check to make5
pageid 1 var5
1 var renderloc5
var renderloc 05
renderloc 0 var5
0 var miid5
added to check5
13 thisclick function5
li akeypressfunctione ifewhich5
function loadgroupeddatacontainer miid5
undefined targetviewlength 05
pmi flexdataid groupyear5
flexdataid groupyear groupmonth5
loadgroupeddatacontainer miid pmi5
groupby targetview tag5
targetview tag iftargetview5
iftargetview undefined targetviewlength5
targetviewlength 0 targetview5
loaddatacontainer miid pmi5
0 targetview looks5
hidden detail view5
detail view defined5
builder view targetview5
view targetview hid-miid-detailviewval5
targetview hid-miid-detailviewval getcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid5
hid-miid-detailviewval getcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid5
miid pmi flexdataid5
groupmonth groupby targetview5
function loaddatacontainer miid5
renderloc0fromrenderloc0groupyear groupyear groupmonth5
miid pmi groupyear5
pmi groupyear groupmonth5
groupmonth groupby tag5
groupby tag viewtouse5
chksidebar function loaddatacontainer5
pmi renderloc0fromrenderloc0groupyear groupyear5
pagemoduleinstanceid pmi renderloc0fromrenderloc0groupyear5
groupbyfield groupby enablequirksmode0viewid5
enablequirksmode0viewid viewtouse tag5
tag tag container5
viewtouse tag tag5
tag container 25
groupby enablequirksmode0viewid viewtouse5
thischildrenul if trimsublisthtml4
sublist thischildrenul if4
var sublist thischildrenul4
moshannon valley school3
data var success3
bus schedule 2020-213
health and safety3
thisremoveclasshover var sublist3
sw-channel-dropdownhide thisremoveclasshover var3
data success failure3
var failure callcontrollerfailureresult0errormessage3
var data var3
estopimmediatepropagation epreventdefault30
if ekeycode23
27 escape20
escape key20
key estopimmediatepropagation20
ekeycode 2720
groupyear groupmonth20
comments -115
pagemoduleinstanceid pmi15
miid pagemoduleinstanceid15
getcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid miid15
builder view15
miid pmi15
2 chksidebar15
view defined15
container 215
else if12
pmi flexdataid10
flexdataid groupyear10
bodyonkeydown ui-dialog-overlay-base-modal10
etargetclasslistcontainsdatepicker if10
ui-dialog-overlay-base-modal ui-dialog-overlay10
groupmonth groupmonth10
chksidebar function10
raisedbydatepicker etargetclasslistcontainsdatepicker10
groupmonth groupbyfield10
ui-sw-alert function10
-sidebarlistviewval getcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid10
miid -sidebarlistviewval10
hid- miid10
viewtouse hid-10
0 viewtouse10
ifhid-miid-sidebarlistviewlength 010
viewtouse ifhid-miid-sidebarlistviewlength10
var viewtouse10
view var10
ui-dialog-overlay ui-sw-alert10
var raisedbydatepicker10
function e10
if alertboxid10
datepicker var10
if esc10
check if10
epreventdefault check10
noclick else10
alertboxid noclick10
else alertboxid10
okclick else10
alertboxid okclick10
0 alertboxid10
oklength 010
alertboxid oklength10
no if10
e var10
click ok10
ui-sw-alertattrid click10
alertboxid ui-sw-alertattrid10
var alertboxid10
alert var10
open alert10
get id10
epreventdefault get10
1 if10
swalertopen 110
if swalertopen10
swalertopen ui-sw-alertlength10
var swalertopen10
ui-sw-alertlength if10
groupbyfield groupby10
list view10
remove focus10
raisedbydatepicker estopimmediatepropagation10
if raisedbydatepicker10
close dialog10
sidebar list10
dialog ui-dialog-overlay-closemodalvisiblelastclick10
epreventdefault close10
else remove10
ui-dialog-overlay-closemodalvisiblelastclick else10
viewtouse looks10
focus etargetblur10
etargetblur etargetclasslistremovefocus10
groupmonth groupby10
hidden sidebar10
tag viewtouse10
etargetclasslistremovefocus documentreadyfunction9
var sublist6
if trimsublisthtml6
0 var6
moshannon valley6
documentreadyfunction var6
0 module-content-5
if dialog-overlay-windowlargemodal-bodymoderatecontentlength5
dialog-overlay-windowlargemodal-bodymoderatecontentlength 05
dialog if5
bleed through5
module-content- miidfindui-widget-detailfindui-articleappendnbsp5
settimeoutfunction module-content-5
miidfindui-widget-detailfindui-articleappendnbsp documentreadyfunction5
findtabindexfirstfocus 2005
miid findtabindexfirstfocus5
module-content- miid5
content doesnt5
chksidebar settimeoutfunction5
doesnt bleed5
4 var5
moderated content5
tag enablequirksmode0viewidviewtouse5
trimsublisthtml sublistattraria-hidden5
sublistattraria-hidden trueattraria-expanded5
trueattraria-expanded false5
if eventkeycode5
var domainid5
domainid 45
var pageid5
sure moderated5
pageid 15
1 var5
var renderloc5
renderloc 05
var miid5
make sure5
enablequirksmode0viewidviewtouse container5
loadtaggeddatacontainer miid5
renderloc0fromrenderloc0tag tag5
li akeypressfunctione5
function loaddatacontainer5
documentreadyfunction tag-list5
tag container5
tag tag5
viewtouse tag5
enablequirksmode0viewid viewtouse5
groupby enablequirksmode0viewid5
tag-list li5
akeypressfunctione ifewhich5
pmi renderloc0fromrenderloc0tag5
renderloc0fromrenderloc0groupyear groupyear5
pmi renderloc0fromrenderloc0groupyear5
ifewhich 135
13 thisclick5
thisclick function5
function loadgroupeddatacontainer5
loadgroupeddatacontainer miid5
pmi groupyear5
groupby tag5
safety plan5
documentreadyfunction checkscriptmoduleviewcheckscriptmustache5
groupby targetview5
targetview tag5
pmi tag5
function loadtaggeddatacontainer5
targetview container5
viewid targetview5
tag viewid5
renderloc0fromrenderloc0enablequirksmode0tag tag5
groupby renderloc0fromrenderloc0enablequirksmode0tag5
groupyear groupyear5
flexdataid flexdataid5
hid-miid-detailviewval getcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid5
targetview hid-miid-detailviewval5
view targetview5
detail view5
hidden detail5
targetview looks5
0 targetview5
targetviewlength 05
undefined targetviewlength5
iftargetview undefined5
tag iftargetview5
loaddatacontainer miid5
function if4
activeselectorid aattrhref4
0 if4
bus schedule4
family letter4
thischildrenul if4
sublist thischildrenul4
data var3
active class3
pagenavigationstatecookie function3
activeselectorid aattrtarget3
navs- activeselectorid3
lidata-bcsid activeselectorid3
var success3
data success3
var failure3
failure callcontrollerfailureresult0errormessage3
schedule 2020-213
success failure3
sw-channel-dropdownhide thisremoveclasshover3
thisremoveclasshover var3
valley school3
var data3
if118
var91
function63
052
miid50
alertboxid40
else39
tag35
viewtouse35
pmi30
epreventdefault30
estopimmediatepropagation30
documentreadyfunction30
view30
groupmonth30
groupyear25
ekeycode23
121
groupby20
targetview20
key20
escape20
raisedbydatepicker20
swalertopen20
letter17
open16
216
316
check16
looks15
flexdataid15
chksidebar15
415
defined15
container15
dialog15
comments15
pagemoduleinstanceid15
getcontenthttpswwwmovalleyorgcmsusercontrolsmoduleviewmoduleviewrendererwrapperaspxdomainid4pageid1moduleinstanceid15
builder15
hidden15
families14
set14
activeselectorid13
close13
no13
click12
grade12
li12
remove12
esc11
list11
get11
e11
noclick10
pressed10
datepicker10
etargetclasslistcontainsdatepicker10
ui-dialog-overlay-closemodalvisiblelastclick10
ui-sw-alert10
sidebar10
ui-dialog-overlay10
focus10
etargetblur10
etargetclasslistremovefocus10
navigation10
documentonclick10
okclick10
ifhid-miid-sidebarlistviewlength10
hid-10
id10
ui-dialog-overlay-base-modal10
school10
bodyonkeydown10
oklength10
false10
ui-sw-alertlength10
alert10
groupbyfield10
module-content-10
ui-sw-alertattrid10
ok10
-sidebarlistviewval10
undefined9
page9
58
nbsp8
eventkeycode7
plan7
active6
channel6
swinnerwrapheight6
content6
trimsublisthtml6
moshannon6
success6
data6
sublist6
failure6
valley6
66
sublistattraria-hidden6
href6
targetviewlength5
make5
renderloc0fromrenderloc0tag5
detail5
hid-miid-detailviewval5
renderloc0fromrenderloc0enablequirksmode0tag5
viewid5
iftargetview5
sure5
loadtaggeddatacontainer5
findtabindexfirstfocus5
enablequirksmode0viewidviewtouse5
settimeoutfunction5
75
added5
renderloc5
pageid5
our5
trueattraria-expanded5
sw-channel-dropdownhide5
true5
moderated5
domainid5
doesnt5
all5
tag-list5
akeypressfunctione5
ifewhich5
thisclick5
loadgroupeddatacontainer5
isedit5
userregid5
bus5
2020-215
bleed5
loaddatacontainer5
safety5
checkscriptmoduleviewcheckscriptmustache5
through5
health5
enablequirksmode0viewid5
dialog-overlay-windowlargemodal-bodymoderatecontentlength5
family5
renderloc0fromrenderloc0groupyear5
miidfindui-widget-detailfindui-articleappendnbsp5
documentonmouseover4
home4
84
aattrhref4
district4
pagenavigationstatecookie4
class4
section4
navs-4
sub4
documentonmouseout4
thischildrenul4
cafeteria4
athletic4
pa4
schedule4
wellness4
us4
thisremoveclasshover4
divsw-special-mode-bar3
sitenavulheight3
addoffcanvasmenuheightforsitenav3
special3
height3
eventdateid3
strcookie3
selectschoolulheight3
ulsw-pgmenu-toplevelremoveclasssw-pgmenu-openaddclasssw-pgmenu-closed3
ului-breadcrumbs3
aattrtarget3
menus3
lidata-bcsid3
information3
internet3
return3
activechannelnavtype3
student3
parentzindex3
buttonproplinkhref3
already3
add3
site3
event3
swgotosearchresultspageswsearchinput3
callcontrollerfailureresult0errormessage3
education3
licollapsibleeachfunction3
nav3
chevron3
openpagesubmenuthisparent3
find3
amp3
zindex3
mvknights3

Who hosts Movalley.org?

Movalley.org Hosting Provider Information

Hosted IP Address:52.206.191.232
Hosted Hostname:ec2-52-206-191-232.compute-1.amazonaws.com
Service Provider:AMAZON-AES
Hosted Country:United StatesUS
Location Latitude:39.0481
Location Longitude:-77.4728
Webserver Software:awselb/2.0

Is "AMAZON-AES" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.4810%
Unknown
8.7814%
AS-26496-GO-DADDY-COM-LLC
4.6042%
NAMECHEAP-NET
3.7023%
AMAZON-AES
2.7678%
GoDaddy.com, LLC
2.4095%
UNIFIEDLAYER-AS-1
2.4018%
Fara Negar Pardaz Khuzestan
2.0303%
CONFLUENCE-NETWORK-INC
1.7535%
1&1 Internet AG
1.6915%

HTTP Header Analysis for Movalley.org

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Server: awselb/2.0
Date: Sat, 17 Oct 2020 19:48:58 GMT
Content-Type: text/html
Content-Length: 134
Connection: keep-alive
Location: https://www.movalley.org:443/

Movalley.org Domain Nameserver Information

HostIP AddressCountry
ns5.worldnic.com 162.159.26.110
ns6.worldnic.com 162.159.27.124


Need to find out who hosts Movalley.org?


Domain Registration (WhoIs) information for Movalley.org

 Domain Name: MOVALLEY.ORG
Registry Domain ID: D1594034-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2018-07-31T01:14:18Z
Creation Date: 1998-07-16T04:00:00Z
Registry Expiry Date: 2027-07-15T04:00:00Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization: Moshannon Valley School District
Registrant State/Province: PA
Registrant Country: US
Name Server: NS5.WORLDNIC.COM
Name Server: NS6.WORLDNIC.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-07-08T23:15:49Z

Websites with Similar Names

Moval-aval.casa
Access denied
Moval-aval.digital
Access denied
Moval-aval.pro
Finanzdojo - Sparen. Verdienen. Investieren - Alles Rund ums Geld
Moval.com.ec
Madeval – Passion for design
Moval.com.vc
Home Moval - Moval Móveis
Moval.edu
Missouri Valley College
Moval.fi
MoVal | MoVal delivers experts for demanding IT projects
Movala.com
The domain name movala.com is for sale

Recently Updated Websites

6742bob.com (2 seconds ago.)Fba-koengen.de (3 seconds ago.)Cfcfcfcfcfcfcfcfcfcfcfd.com (4 seconds ago.)Sarnoffart.com (5 seconds ago.)Foundingfather.com (6 seconds ago.)Teleprograms.ru (7 seconds ago.)Notarizedproctor.com (8 seconds ago.)Cartoonslovers.com (10 seconds ago.)Jjamesconstruction.com (11 seconds ago.)Xsroem.com (11 seconds ago.)Nguyenviettrung.com (12 seconds ago.)Simplyshellzbeauty.com (13 seconds ago.)Acno1.com (14 seconds ago.)Insexypanties.com (15 seconds ago.)4c0r6gla.top (15 seconds ago.)Where39.com (18 seconds ago.)Xuesiangli.com (19 seconds ago.)Ourfinanciallife.com (19 seconds ago.)Brishta.com (19 seconds ago.)Jshtyc.com (20 seconds ago.)Fundholcombschools.com (21 seconds ago.)Alpeex.com (22 seconds ago.)Prekrasna.bg (22 seconds ago.)Laurenbernazza.com (24 seconds ago.)Meaghaninfrance.com (25 seconds ago.)Gwaillnara.com (25 seconds ago.)Covid-19rule.com (26 seconds ago.)Bedavabahisci.com (26 seconds ago.)Mesotek.com (27 seconds ago.)Coinquik.com (28 seconds ago.)

Recently Searched Keywords

antep (1 second ago.)中国围棋名人战开战 4世界冠军遭遇“滑铁卢” (1 second ago.)oulu (1 second ago.)0 9 0 (1 second ago.)8cffed 0 (2 seconds ago.)ansbach (3 seconds ago.)avatargroup3989799801textbutton (3 seconds ago.)viking1914 (4 seconds ago.)bazie whois (4 seconds ago.)hornos, estufas y muflas (4 seconds ago.)puma benita (4 seconds ago.)amritsar call girls (5 seconds ago.)panch tulsi drop (6 seconds ago.)american studies (8 seconds ago.)accs direct (8 seconds ago.)madam chief minister movie review (9 seconds ago.)allowinfscroll (10 seconds ago.)rent space (10 seconds ago.)0342 502 (10 seconds ago.)autoplay clipboard-write (11 seconds ago.)ada compliant (13 seconds ago.)kada (14 seconds ago.)acoso (14 seconds ago.)legium (15 seconds ago.)カラコン (16 seconds ago.)a股大比例减持频现 (16 seconds ago.)approved trade source systems (18 seconds ago.)yts app (18 seconds ago.)900 купить (18 seconds ago.)win iphones (19 seconds ago.)