Mozilla.org Website Analysis Summary

Mozilla.org  |  Internet for people, not profit Mozilla
High trust score  | 
Internet for people, not profit Mozilla


Rank
215
Rating
A
Trust Score
High trust score
Estimated worth
$75,147,480
Estimated daily income
$69,581
Estimated monthly income
$2,116,422
Backlinks
0

Mozilla.org has a High trust score, and a Statvoo Rank of A.

Mozilla.org is hosted by Mozilla Corporation in California, Mountain View, United States, 94041.
Mozilla.org has an IP Address of 63.245.215.20 and a hostname of bedrock-prod-zlb.vips.scl3.mozilla.com.

The domain mozilla.org was registered 201 decades 9 years 4 months ago by , it was last modified 201 decades 9 years 4 months ago and currently is set to expire 201 decades 9 years 4 months ago.

It is the world's 215 most popular site among over 300 million websites.

Mozilla.org has a total of 0 backlinks.

Mozilla.org gets approximately 8,697,674 unique visitors a day and 69,581,392 pageviews per day.

Mozilla.org has an estimated worth of $75,147,480.
An average daily income of approximately $69,581, which is wroughly $2,116,422 per month.

Whois information for mozilla.org

Full Whois Lookup for Mozilla.org Whois Lookup

Domain Name: MOZILLA.ORG
Registry Domain ID: D1409563-LROR
Registrar WHOIS Server:
Registrar URL: http://www.markmonitor.com
Updated Date: 2016-12-22T10:04:31Z
Creation Date: 1998-01-24T05:00:00Z
Registry Expiry Date: 2019-01-23T05:00:00Z
Registrar Registration Expiration Date:
Registrar: MarkMonitor Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: C49620406-LROR
Registrant Name: DNS Admin
Registrant Organization: Mozilla Corporation
Registrant Street: 331 E. Evelyn Ave
Registrant City: Mountain View
Registrant State/Province: CA
Registrant Postal Code: 94041
Registrant Country: US
Registrant Phone: +1.6509030800
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C49620406-LROR
Admin Name: DNS Admin
Admin Organization: Mozilla Corporation
Admin Street: 331 E. Evelyn Ave
Admin City: Mountain View
Admin State/Province: CA
Admin Postal Code: 94041
Admin Country: US
Admin Phone: +1.6509030800
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C49620406-LROR
Tech Name: DNS Admin
Tech Organization: Mozilla Corporation
Tech Street: 331 E. Evelyn Ave
Tech City: Mountain View
Tech State/Province: CA
Tech Postal Code: 94041
Tech Country: US
Tech Phone: +1.6509030800
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: NS5-65.AKAM.NET
Name Server: NS7-66.AKAM.NET
Name Server: NS4-64.AKAM.NET
Name Server: NS1-240.AKAM.NET
DNSSEC: signedDelegation
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-16T11:10:40Z

Who hosts Mozilla.org?

Mozilla.org Web Server Information

Hosted IP Address:63.245.215.20
Hosted Hostname:bedrock-prod-zlb.vips.scl3.mozilla.com
Service Provider:Mozilla Corporation
Hosted Country:United StatesUS
Location Latitude:37.3885
Location Longitude:-122.0741
Webserver Software:Not Applicable

HTTP Header Analysis for Mozilla.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache
X-Backend-Server: bedrock4.webapp.scl3.mozilla.com
Vary: Accept-Encoding
Cache-Control: max-age=600
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Date: Thu, 17 Dec 2015 12:10:58 GMT
Expires: Thu, 17 Dec 2015 12:20:58 GMT
Transfer-Encoding: chunked
X-Robots-Tag: noodp
X-Frame-Options: DENY
X-Cache-Info: caching
X-Clacks-Overhead: GNU Terry Pratchett

Need to find out who hosts Mozilla.org?

Mozilla.org Free SEO Report

Website Inpage Analysis for Mozilla.org

H1 Headings:1
Internet for people, not profit
H2 Headings:28
Add-ons
Mozilla WebVR
Firefox Developer Edition
Mozilla Manifesto
Reclaim your privacy
Get privacy beyond the browser
Get 2,000+ trackers off your trail
*Privacy Not Included
Don't let your gifts get spoiled
That’s a wrap
Feel safer on public WiFi
More power to you.
Monitor watches for account breaches
Lockwise remembers passwords for you
Our collective privacy problem is not your fault
ISPs lied to Congress to spread confusion about encrypted DNS, Mozilla says
Mozilla Asks Congress to Investigate ISPs Data Collection Practices
Here’s how to see who’s tracking you across the Web right now
Spoke: the Architecture Kit
Princesses make terrible passwords
Support a healthy internet.
No soup for these friendly passwords
Troubleshoot keyboard accessibility
Open source. Open minds.
The Firefox browser made for developers
Have a minute? Donate your voice
Privacy over profit
The account that protects you rather than profits off you.
H3 Headings:5
Take back your privacy
Firefox is more than a browser
What we’re reading:
Love the Web?
Thanks!
H4 Headings:18
Firefox Desktop Browser
Firefox Mobile Browsers
Pocket by Firefox
Your Firefox Account
Firefox for Enterprise
Firefox for Fire TV
Common Voice
Firefox Reality
Web of Things (IoT)
Hubs
Firefox Developer Edition
Firefox Beta
Firefox Nightly
Developer Innovations
Resources
Mozilla
Careers
Get involved
H5 Headings:4
Company
Developers
Resources
Product Help
H6 Headings:0
Total IFRAMEs:0
Total Images:53
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Mozilla.org

espaoldownload firefoxdownloadfirefox downloadfrenchprivacykeephealthyfreerequirementsinternet healthmozillameetourfirefoxrepublicunitedhealthaccessiblesaintsupportenglishaccessible to allyouallislandfirefox download firefoxbritishinternetkeep the internetsystemwehelpportugusnewislandsopen and accessiblebrowserguineapocketsouthtechnologyioslinux64bitgetuswindowsyour systemopenwebmeet the requirementsandroidnotinnovationsyourfacebookdownload firefox downloadinternet healthy

Longtail Keyword Density for Mozilla.org

KeywordsOccurences
firefox download firefox9
download firefox download7
accessible to all3
open and accessible3
keep the internet3
meet the requirements3
download firefox11
firefox download9
internet health4
internet healthy3
your system3
firefox26
islands20
browser13
mozilla13
internet13
island13
download11
web10
us10
get8
your8
open7
our7
you7
saint7
windows6
privacy6
healthy6
espaol5
english5
all5
keep5
south5
new5
health4
help4
android4
ios4
linux4
pocket4
64-bit4
republic3
british3
portugus3
united3
french3
guinea3
support3
meet3
not3
system3
technology3
requirements3
facebook3
we3
accessible3
innovations3
free3

What are the nameservers for mozilla.org?

Mozilla.org Domain Nameserver Information

HostIP AddressCountry
ns5-65.akam.net 184.85.248.65United States United States
ns7-66.akam.net 96.7.49.66United States United States
ns4-64.akam.net 84.53.139.64United States United States