Moved permanently / Dauerhaft verschoben

Safety: High trust score
Year Founded: 2021
Global Traffic Rank: 1,775
Estimated Worth: $8,881,920
Category: Science > Physics

Die Max-Planck-Gesellschaft ist Deutschlands führende außeruniversitäre Forschungsorganisation, die sich der Grundlagenforschung und der Unterstützung und Förderung des wissenschaftlichen Nachwuchses in vielen Disziplinen widmet. 86 Max-Planck-Institute betreiben Spitzenforschung in den Lebens- und Naturwissenschaften sowie den Sozial- und Geist...



Domain summary

Last updated
2021-03-23
Domain label
mpg
Domain extension
de
Global Traffic Rank
1,775
Statvoo Rating
B
Trust Score
High trust score
Estimated worth
$8,881,920
Estimated daily income
$8,224
Estimated monthly income
$250,147

Frequently Asked Questions (FAQ)

Q: When was Mpg.de registered?
A: Mpg.de was registered 2 months, 3 weeks, 3 days, 23 hours, 29 minutes, 29 seconds ago on Tuesday, March 23, 2021.
Q: When was the WHOIS for Mpg.de last updated?
A: The WHOIS entry was last updated 8 months, 3 weeks, 4 days, 23 hours, 29 minutes, 29 seconds ago on Monday, September 21, 2020.
Q: What are Mpg.de's nameservers?
A: DNS for Mpg.de is provided by the following nameservers:
  • ns1.es.net
Q: Who is the registrar for the Mpg.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Mpg.de?
A: Mpg.de ranks 1,775 globally on Alexa. Mpg.de has a High trust score, and a Statvoo Rank of B.
Q: How many people visit Mpg.de each day?
A: Mpg.de receives approximately 1,028,037 visitors and 8,224,296 page impressions per day.
Q: What IP address does Mpg.de resolve to?
A: Mpg.de resolves to the IPv4 address 134.76.31.198.
Q: In what country are Mpg.de servers located in?
A: Mpg.de has servers located in the Germany.
Q: What webserver software does Mpg.de use?
A: Mpg.de is powered by Apache webserver.
Q: Who hosts Mpg.de?
A: Mpg.de is hosted by Verein zur Foerderung eines Deutschen Forschungsnetzes e.V. in Bavaria, Munich, Germany, 80539.
Q: How much is Mpg.de worth?
A: Mpg.de has an estimated worth of $8,881,920. An average daily income of approximately $8,224, which is roughly $250,147 per month.

Mpg.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Mpg.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Mpg.de

H1 Headings

3 :
  1. Page has moved permanently
  2. Seite dauerhaft verschoben
  3. 30 Jahre Asdex Upgrade

H2 Headings

7 :
  1. Aktuelles
  2. Corona-Pandemie
  3. Multimedia
  4. Publikationen
  5. Karriere
  6. Aus den Instituten
  7. Soziale Medien

H3 Headings

21 :
  1. Big Science
  2. Im Herz des Fusionsanlage
  3. Energiequelle Kernfusion
  4. Belebung des Immunsystems zur Krebsabwehr
  5. Die Digitalisierung im Spiel besiegen
  6. Früherkennung für Finanzblasen
  7. „Wer am Patentschutz rüttelt, spielt mit dem Feuer“
  8. Neuer Corona-Test entwickelt
  9. Von Corona angesteckt
  10. Plan B zur Kühlung der Erde
  11. Vier Fragen an Lisa Windsteiger
  12. Wie sich das Immunsystem zu wehren lernt
  13. So anders und doch so gleich
  14. Hass im Netz
  15. „Das macht Depressionen viel greifbarer“
  16. Ökozid – ein fiktives Zukunftsszenario
  17. Wie entsteht Superdiversität?
  18. Schwarze Löcher - das Unsichtbare erforschen
  19. Frauen in der Forschung
  20. Höhere Bezahlung für Promovierende
  21. Stellenangebote

H4 Headings

5 :
  1. Mitarbeiter/in (m/w/d) in der Institutsverwaltung für die Personalsachbearbeitung.
  2. Praktikant:in (m/w/d) für den Bereich Finanzen
  3. Erfahrener Windows-Administrator (m/w/d)
  4. Quick Links
  5. Social Media

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

2 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

245:

Links - Outbound (nofollow)

0:

Keyword Cloud for Mpg.de

2sichmpi fr marineam maxplanckinstitutmaxplanckinstitut frvomrechtswissenschaftenmpi frauchpodcast3januarasdex upgradefr biologischemehr mpi frfunctionsihredieupgrademarine0demfr marineplanck16 mrz4aufmarine mikrobiologiempimrz 2021maxplanckinstitutampzuder erdenachzurvom maxplanckinstitut fr2021 coronawieausmrz9 mrz16 mrz 2021fr marine mikrobiologieeinasdexsozialwissenschaftenvideoerdedas9 mrz 2021mitmanfrvonberhaben6mwd17 mrz 2021physikvardenfebruar 2021coronamehrammenschenpsychologiealumni1desvom maxplanckinstitutmaxplanckgesellschaft7dermehr mpibiologischemaxplanckwissenschaftlerinnenimmikrobiologiesie17 mrz5februar

Who hosts Mpg.de?

Mpg.de Hosting Provider Information

Hosted IP Address:134.76.31.198
Hosted Hostname:www.mpg.de
Service Provider:Verein zur Foerderung eines Deutschen Forschungsnetzes e.V.
Hosted Country:GermanyDE
Location Latitude:48.1497
Location Longitude:11.585
Webserver Software:Apache

Is "Verein zur Foerderung eines Deutschen Forschungsnetzes e.V." in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
17.1842%
AS-26496-GO-DADDY-COM-LLC
4.0884%
NAMECHEAP-NET
3.5315%
GoDaddy.com, LLC
2.6631%
AMAZON-AES
2.5761%
UNIFIEDLAYER-AS-1
2.1530%
Fara Negar Pardaz Khuzestan
1.9418%
Unknown
1.8112%
1&1 Internet AG
1.6678%
CONFLUENCE-NETWORK-INC
1.6554%
%

HTTP Header Analysis for Mpg.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache
Cache-Control: max-age=120, public
Referrer-Policy: strict-origin-when-cross-origin
X-Permitted-Cross-Domain-Policies: none
X-XSS-Protection: 1; mode=block
X-Request-Id: 95709084-d342-48f2-a99f-5e13bf043af6
X-Download-Options: noopen
X-UA-Compatible: IE=Edge
X-Content-Type-Options: nosniff
Content-Security-Policy: frame-ancestors 'self' piwik.mpg.de statistics.mpg.de analytics.mpg.de;
ETag: W/"7af7cf08a8be57ec2f054d59f8a87bc7"
Vary: Accept-Encoding
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Accept-Ranges: bytes
Connection: close
Date: Tue, 23 Mar 2021 02:15:36 GMT
Age: 8
Content-Length: 41310

Mpg.de Domain Nameserver Information

HostIP AddressCountry
ns1.es.net 198.128.2.10United States United States


Need to find out who hosts Mpg.de?


Domain Registration (WhoIs) information for Mpg.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: mpg.de
Nserver: dns1.gwdg.de
Nserver: dns2.gwdg.de
Nserver: dns3.gwdg.de
Nserver: ns1.es.net
Nserver: sat.rzg.mpg.de 130.183.1.21
Dnskey: 257 3 10 AwEAAbGVd9ANmpnoVRIyCAln2nx4FOpa4T22x4L3vX2Dp4Zi2PWWVRrDnoiAMlDRaheV+f+fQSdZaYqQK4EdKNLAi6zWtrzAkbSl2+BRDmSLbC0xRrb7MIhLqnK5xDWIJTTYPMqYq3V3uVJE29YyOxEK7TXVsUggBu0PHEQCnVWzTS4LOIvxFwn2SK5iMzhzA3Jfj8JsQxg6gOfuhAzRNJyqim8jkULPDTmk9cu72+7LX1Dj0U8qFOJ2ckQneRbuyTaQbg9bx2aL4Hc1y/O2pWkYkdvAY4kxESTf2LHkOym3IHOL07SdbHY3RJIPfX85jzK5ma1N0E0l6nUIxPJsvKe/Urk=
Dnskey: 257 3 10 AwEAAbrOrWM96WkZNfydU2Z86f4KETGScbouvf5WmoGsJ5aBAU85GLPTBbQhCnnOcUctbMmWbO2X4x+4VAbrl8ZeLPiEJDxDdQEI7s2Csi9T/VAqKrRZHmRi6PAAW+r2vdJbTZ0F/gFiFO4dtpCEfyZ4AXKtVaCcomtsFKoWRLN1IgEtaIh9FnB7RROLj00YjsSU0D8WG8i/mo2j35/9s47eWmBD1EbLedJlP9K/SsWGJ8APE7BBE/Q6fOKWpNjGnc9qJbN24wgr1af1/E8OcNHDOsFJOSPYObwSUcfpfLlbLNVM5KgZABfb1NLoEmv23vgVKaqCquYMQQOcn7hkbnoTV7E=
Status: connect
Changed: 2020-09-21T16:56:52+02:00

Websites with Similar Names

Mpg-asia.com
HOME | MPG Asia
Mpg-assets.com
Madison Property Group
Mpg-beds.com
WordPress › Error
Mpg-berlin.de
Max Planck Gymnasium
Mpg-calculator.com
MPG-Calculator
Mpg-corporation.com
mpg-corporation.com
Mpg-dortmund.de
Max-Planck-Gymnasium
Mpg-drive.com
WordPress › Error

Recently Updated Websites

Globaloffshorehost.com (4 seconds ago.)Milkbankmidwivesnetwork.org (5 seconds ago.)Getconnectedamerica.com (6 seconds ago.)Flippingbizbook.com (6 seconds ago.)Thepickupgamefilm.com (7 seconds ago.)Ryangillett.com (7 seconds ago.)771989.com (8 seconds ago.)Katalogbas.com (8 seconds ago.)Bestbusinessphones.com (9 seconds ago.)Thegagooseheadagent.com (11 seconds ago.)Ccahavasu.com (11 seconds ago.)Glicolinato.com (13 seconds ago.)Climasenmonterrey.com (13 seconds ago.)Lnovel.cc (14 seconds ago.)Youngukraineporn.com (14 seconds ago.)Yyvip4670.com (15 seconds ago.)Tb81.app (15 seconds ago.)Tekgalaxy.us (15 seconds ago.)Dazga.ge (15 seconds ago.)Ohioonlinesportstips.com (16 seconds ago.)Mission-travel.com (16 seconds ago.)Blackandwhiteagency.com (16 seconds ago.)Hgproddedivalue616sin516.com (17 seconds ago.)Ellieivanovaphotography.com (17 seconds ago.)Alfina-baha.com (19 seconds ago.)Africabunker.com (20 seconds ago.)Flightstocebu.com (21 seconds ago.)Bomapressclub.com (21 seconds ago.)7miai.com (21 seconds ago.)Aspireccc.org (22 seconds ago.)

Recently Searched Keywords

etpbnewsletterform p inputtypecheckboxlabel (1 second ago.)zilchband (1 second ago.)russian mature53.5k (2 seconds ago.)glamour porn (2 seconds ago.)proseriftext-decoration line-heightnormaltpasectionk2cof6j5 (6 seconds ago.)ffentlichen (7 seconds ago.)medina islam (7 seconds ago.)покупка на аукционе ebey (8 seconds ago.)1xbit bonus (9 seconds ago.)transformation success (10 seconds ago.)langstroth hive plans (11 seconds ago.)guide enseignants (15 seconds ago.)100background-image linear-gradientto (16 seconds ago.)lynch-bages 2016 (17 seconds ago.)noulei filament (19 seconds ago.)how to catch a star (20 seconds ago.)fast business plans rental property (21 seconds ago.)hng nbsp qu (21 seconds ago.)themeforest (22 seconds ago.)jazz choir pieces (23 seconds ago.)dnew admaxclientdadmaxadparamsfunction (24 seconds ago.)0 10pxcolor (25 seconds ago.)2020-12-10 4 2020-12-10 (25 seconds ago.)tmpbutton-53630 (26 seconds ago.)حوادث (27 seconds ago.)禽蛋肉及制品 (28 seconds ago.)48 48 04 (28 seconds ago.)girls eating pussy (29 seconds ago.)michał olaś (31 seconds ago.)property search (33 seconds ago.)