|  MSN UK Home | Latest news, Hotmail login, Outlook email, live scores
High trust score  | 
Today's top stories across news, weather, sport, entertainment, lifestyle, money, cars and more - expertly curated from across top UK and global news providers. Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:A+
Alexa Rank Alexa Rank:31
Majestic Rank Majestic Rank:50
Domain Authority Domain Authority:98%
DMOZ DMOZ Listing:No

Domain Information for

Domain Registrar: MARKMONITOR INC.
Registration Date:1994-11-10  2 decades 4 years 5 months ago
Last Modified:2014-10-08  4 years 6 months 2 weeks ago
Expiration Date:2022-06-04  3 years 1 month 1 week from now

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: MSN.COM
Registry Domain ID: 4569290_DOMAIN_COM-VRSN
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2014-10-08T18:25:01Z
Creation Date: 1994-11-10T05:00:00Z
Registry Expiry Date: 2022-06-04T16:44:29Z
Registrar: MarkMonitor Inc.
Registrar IANA ID: 292
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2083895740
Domain Status: clientDeleteProhibited
Domain Status: clientTransferProhibited
Domain Status: clientUpdateProhibited
Domain Status: serverDeleteProhibited
Domain Status: serverTransferProhibited
Domain Status: serverUpdateProhibited
Name Server: NS1.MSFT.NET
Name Server: NS2.MSFT.NET
Name Server: NS3.MSFT.NET
Name Server: NS4.MSFT.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of whois database: 2017-08-16T10:57:14Z

Who hosts is hosted by Microsoft Corporation in California, United States. has an IP Address of and a hostname of and runs Microsoft-IIS/8.5 web server. Web Server Information

Hosted IP Address:
Hosted Hostname:
Service Provider:Microsoft Corporation
Hosted Country:United StatesUS
Location Latitude:34.0522
Location Longitude:-118.2437
Webserver Software:Microsoft-IIS/8.5

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: no-cache, no-store, no-transform
Pragma: no-cache
Content-Length: 62824
Content-Type: text/html; charset=utf-8
Content-Encoding: gzip
Expires: -1
Vary: User-Agent
Server: Microsoft-IIS/8.5
Access-Control-Allow-Origin: *
X-AspNetMvc-Version: 5.2
X-AppVersion: 2.0.5942.29746
X-Activity-Id: 83f2de53-298d-4d54-9a33-bb314a6dd3e7
X-Az: {did:af710c439e834ffabdc28d5e97f2c117, rid: 62, sn: westeu-hp, dt: 2016-04-02T01:28:36.6621080Z, bt: 2016-04-09T00:32:12.9025766Z}
X-Content-Type-Options: nosniff
X-UA-Compatible: IE=Edge;chrome=1
X-Powered-By: ASP.NET
Access-Control-Allow-Methods: HEAD,GET,OPTIONS
X-XSS-Protection: 1
X-MSEdge-Ref: Ref A: 83F2DE53298D4D549A33BB314A6DD3E7 Ref B: 94FAFF3CB2834446A71DC6270DA475AD Ref C: Mon Apr 18 08:08:51 2016 PST
Date: Mon, 18 Apr 2016 15:08:50 GMT

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

health amp fitnessfood ampsportdrinkifyouentertainmentmost0ridwitnessamp drinkhealth amplifestylenewneedampfitnessmediatoronlytraveluknewspageinstance mediatorafterstarneed to knowwitness starsilentmsnusingfood amp drinkmoresponsoredknowyoururlfoodhealthamp fitnesscarsyou needsilent witness starpageinstancevarsilent witnessmoneyheaddata

Longtail Keyword Density for

need to know3
silent witness star3
food amp drink3
health amp fitness3
pageinstance mediator4
witness star3
you need3
silent witness3
amp drink3
amp fitness3
food amp3
health amp3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States Kingdom United Kingdom States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?