|  MTA | Subway, Bus, Long Island Rail Road, Metro-North
High trust score  | Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:B
Alexa Rank Alexa Rank:9,450
Majestic Rank Majestic Rank:4,372
Domain Authority Domain Authority:85%
DMOZ DMOZ Listing:No

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: MTA.INFO
Registry Domain ID: D33777-LRMS
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2016-06-03T19:33:08Z
Creation Date: 2001-07-31T20:41:01Z
Registry Expiry Date: 2019-07-31T20:41:01Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited
Registry Registrant ID: C170623192-LRMS
Registrant Organization:
Registrant Street: 12808 Gran Bay Parkway West
Registrant Street: care of Network Solutions
Registrant Street: PO Box 459
Registrant City: Jacksonville
Registrant State/Province: FL
Registrant Postal Code: 32258
Registrant Country: US
Registrant Phone: +1.5707088780
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C156157827-LRMS
Admin Organization:
Admin Street: 12808 Gran Bay Parkway West
Admin Street: care of Network Solutions
Admin Street: PO Box 459
Admin City: Jacksonville
Admin State/Province: FL
Admin Postal Code: 32258
Admin Country: US
Admin Phone: +1.5707088780
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C156157827-LRMS
Tech Organization:
Tech Street: 12808 Gran Bay Parkway West
Tech Street: care of Network Solutions
Tech Street: PO Box 459
Tech City: Jacksonville
Tech State/Province: FL
Tech Postal Code: 32258
Tech Country: US
Tech Phone: +1.5707088780
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Billing ID: C170623191-LRMS
Billing Organization:
Billing Street: 12808 Gran Bay Parkway West
Billing Street: care of Network Solutions
Billing Street: PO Box 459
Billing City: Jacksonville
Billing State/Province: FL
Billing Postal Code: 32258
Billing Country: US
Billing Phone: +1.5707088780
Billing Phone Ext:
Billing Fax:
Billing Fax Ext:
Billing Email: Login to show email
Name Server: ASIA3.AKAM.NET
Name Server: ASIA2.AKAM.NET
Name Server: USE2.AKAM.NET
Name Server: EUR2.AKAM.NET
Name Server: EUR5.AKAM.NET
Name Server: NS1-128.AKAM.NET
Name Server: NS1-49.AKAM.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of WHOIS database: 2017-08-16T14:29:46Z

Who hosts Web Server Information

Hosted IP Address:
Hosted Hostname:a23-74-101-16.deploy.static.akamaitechnologie
Service Provider:Akamai International B.V.
Hosted Country:United KingdomGB
Location Latitude:51.5085
Location Longitude:-0.12574
Webserver Software:Not Applicable

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Accept-Ranges: bytes
Content-Encoding: gzip
Content-Language: en
Content-Type: text/html; charset=utf-8
ETag: "1433883931-1"
Last-Modified: Tue, 09 Jun 2015 21:05:31 GMT
Link:; rel="shortlink",; rel="canonical"
Server: nginx
X-AH-Environment: prod
X-Content-Type-Options: nosniff
X-Drupal-Cache: MISS
X-Frame-Options: SameOrigin
X-Generator: Drupal 7 (
X-Request-ID: v-43942cca-0eeb-11e5-aad1-22000a91a1cd
X-Trace: 1B2AC3CB69E6631ACF5D5E029FD6F19EE872EFA1112ADAAA1745A9356F
X-Varnish: 1926468396
Content-Length: 19338
Cache-Control: public, max-age=35
Expires: Tue, 09 Jun 2015 21:08:21 GMT
Date: Tue, 09 Jun 2015 21:07:46 GMT
Connection: keep-alive
Vary: Accept-Encoding

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:pub-0982027042052701
Google Analytics:Not Applicable

Keyword Cloud for

nowdocumentgetelementbyiddivsiastylebackgroundcolorbridgestollsdocumentgetelementbyiddivendaddressstyledisplay blockreduced faremyrtleusstaten islandworkdocumentgetelementbyidspanadvstyledisplayamplongclick lefteasypayfree emailtext alertsblock documentgetelementbyiddivendaddressstyledisplay blockloadampmif loadhourmetronorthweekend workfalseprogrambreak casecookieloadednone documentgetelementbyiddivleavearrstyledisplay nonesubwaymail billfilenameschedulespretaxcheckvar00c521youdeals amp getawaysbusmaillong island railviaductuproad metronorth railroadlandmarkloadedbenefitstripmapblock documentgetelementbyiddivendaddressstyledisplaydocumentformstpsubmitactionpaymetrocardridenone documentgetelementbyidtpformstyledisplay blockveloadedxpay tollscustomerdocumentgetelementbyiddivendaddressstyledisplayclickgetawaysdocumentgetelementbyiddivtransitmodestyledisplayfirstclickdocumentgetelementbyiddivleavearrstyledisplaydocumentgetelementbyidlabelforstartaddressinnertextgetairportsbuseselevatoremailtext alertsdocumentgetelementbyidtpformstyledisplayfare easypayblock documentgetelementbyidlbltimestyledisplaymapstpaddressdefaultmsgblock documentgetelementbyiddivtransitmodestyledisplayclick right3newemailtextcarmyrtle viaductdocumentgetelementbyidtpformstyledisplay blockdocumentgetelementbyiddivsiastylecolorobjfuture2faresloadeddocumentgetelementbyiddivp2pheadlinestyledisplayyorktripplannerextloadedeastdocumentgetelementbyiddivcpstylecolordocumentgetelementbyidcurrentmodulevaluetunnelsfalse varlostbillbuttondocumentgetelementbyiddivschstylebackgroundcolorfilescheckifscriptsloadedojecttype obj tofromroad metronorthaccessibilitymain page schedulesloadhourisland rail roadleftdatecheckifscriptsloadedojecttypefoundmtafreedocumentgetelementbyiddivleavearrstyledisplay nonetrainportlost ampsubmitocallbackfilenamedocumentgetelementbyiddivschstylecolornone documentgetelementbyiddivleavearrstyledisplayobj tofrommainbus timebridges ampstationrighttakereconstructionblock documentgetelementbyidlbltimestyledisplay blockffffffstatenbayservicemilepagereducednew yorkmta bustravelstatuscasehiddentruefunctiondocumentgetelementbyiddivp2pheadlinestyledisplay none documentgetelementbyidschmenulinksstyledisplaygolost amp foundjs fileshudsontolls by mailfree emailtexttofromdocumentgetelementbyiddivtransitmodestyledisplay noneswitchdocumentgetelementbyiddivp2pheadlinestyledisplay nonerail roadezpassbusinesselse0checkifscriptsloadedojecttype objdocumentgetelementbyidlbltimestyledisplay blockfares metrocard reducedopportunitiesrail road metronorth1reduced fare easypayjsonloadedweekenderrailjsdealsmobilelirrdocumentgetelementbyidschmenulinksstyledisplayloaddocumentgetelementbyiddivtransitmodestyledisplay none documentgetelementbyiddivleavearrstyledisplayfuture datenonetransitinformationmetronorth railroadmta bus timeweekendlong islandpage schedulesdocumentgetelementbyidlbltimestyledisplayisland railstationstransit benefitsnone documentgetelementbyidschmenulinksstyledisplayalertsyourtrue break casetimeamp getawaysblockroadnone documentgetelementbyidtpformstyledisplayfaredocumentgetelementbyiddivwalkdiststyledisplayislandavenueamp founddocumentgetelementbyiddivcpstylebackgroundcolordocumentgetelementbyiddivwalkdiststyledisplay blockappifbridges amp tunnelsdocumentgetelementbyidschmenulinksstyledisplay nonemoredocumentgetelementbyidschmenulinksstyledisplay none documentgetelementbyidtpformstyledisplaylinefares metrocardamp tunnelsdeals ampmain pageelevatorescalator statusmetrocard reducedelevatorescalatorrailroad000000true breaktollmetrocard reduced farebreakloadhour 12address

Longtail Keyword Density for

island rail road6
long island rail6
mta bus time5
lost amp found4
true break case4
documentgetelementbyiddivp2pheadlinestyledisplay none documentgetelementbyidschmenulinksstyledisplay3
documentgetelementbyidschmenulinksstyledisplay none documentgetelementbyidtpformstyledisplay3
block documentgetelementbyiddivendaddressstyledisplay block3
none documentgetelementbyiddivleavearrstyledisplay none3
documentgetelementbyiddivtransitmodestyledisplay none documentgetelementbyiddivleavearrstyledisplay3
block documentgetelementbyidlbltimestyledisplay block3
checkifscriptsloadedojecttype obj tofrom3
none documentgetelementbyidtpformstyledisplay block3
main page schedules3
road metro-north railroad3
rail road metro-north3
bridges amp tunnels3
fares metrocard reduced3
metrocard reduced fare3
deals amp getaways3
free emailtext alerts3
reduced fare easypay3
tolls by mail3
break case10
island rail8
main page6
long island6
rail road6
mta bus5
true break5
metro-north railroad5
false var5
bus time5
lost amp4
amp found4
click left4
click right4
obj tofrom4
pay tolls4
block documentgetelementbyiddivendaddressstyledisplay4
reduced fare4
weekend work4
future date4
documentgetelementbyiddivtransitmodestyledisplay none3
documentgetelementbyiddivleavearrstyledisplay none3
checkifscriptsloadedojecttype obj3
js files3
documentgetelementbyidlbltimestyledisplay block3
none documentgetelementbyiddivleavearrstyledisplay3
documentgetelementbyiddivp2pheadlinestyledisplay none3
documentgetelementbyidschmenulinksstyledisplay none3
none documentgetelementbyidtpformstyledisplay3
documentgetelementbyidtpformstyledisplay block3
documentgetelementbyiddivendaddressstyledisplay block3
block documentgetelementbyiddivtransitmodestyledisplay3
documentgetelementbyiddivwalkdiststyledisplay block3
none documentgetelementbyidschmenulinksstyledisplay3
block documentgetelementbyidlbltimestyledisplay3
deals amp3
road metro-north3
fares metrocard3
metrocard reduced3
staten island3
new york3
bridges amp3
amp tunnels3
myrtle viaduct3
fare easypay3
free emailtext3
amp getaways3
mail bill3
if loadhour3
page schedules3
transit benefits3
emailtext alerts3
elevatorescalator status3
loadhour 123

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry States United States States United States States United States Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?