Mullanpurplots.net  |  Buy | Sell | Property in Mullanpur New Chandigarh - Mullanpur Plots | Flats | Commercial | Property
Low trust score  | 
Mullanpur New Chandigarh the first eco township of India.Many developers offering plots,flats,floor ,serviced apartments and other commercial property in mullapur




Mullanpurplots.net Website Information

Website Ranks & Scores for Mullanpurplots.net

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:0
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Domain Information for Mullanpurplots.net

Domain Registrar: BIGROCK SOLUTIONS LIMITED
Registration Date:2012-08-24  6 years 8 months 3 weeks ago
Last Modified:2015-07-27  3 years 9 months 3 weeks ago
Expiration Date:2018-08-24  8 months 3 weeks 3 days ago

Whois information for mullanpurplots.net

Full Whois Lookup for Mullanpurplots.net Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Mullanpurplots.net. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: MULLANPURPLOTS.NET
Registry Domain ID: 1740474009_DOMAIN_NET-VRSN
Registrar WHOIS Server: Whois.bigrock.com
Registrar URL: http://www.bigrock.com
Updated Date: 2015-07-27T06:29:07Z
Creation Date: 2012-08-24T06:10:13Z
Registry Expiry Date: 2018-08-24T06:10:13Z
Registrar: BigRock Solutions Limited
Registrar IANA ID: 1495
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.2013775952
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS01.ONE.COM
Name Server: NS02.ONE.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-09-03T12:43:09Z

Who hosts Mullanpurplots.net?

Mullanpurplots.net is hosted by One.com A/S in Denmark.
Mullanpurplots.net has an IP Address of 46.30.212.250 and a hostname of webcluster250.one.com.



Mullanpurplots.net Web Server Information

Hosted IP Address:46.30.212.250
Hosted Hostname:webcluster250.one.com
Service Provider:One.com A/S
Hosted Country:DenmarkDK
Location Latitude:55.6761
Location Longitude:12.5683
Webserver Software:Not Applicable

HTTP Header Analysis for Mullanpurplots.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache
X-Powered-By: PHP/5.6.16
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Type: text/html; charset=UTF-8
Content-Length: 4668
Accept-Ranges: bytes
Date: Sat, 09 Jan 2016 06:15:51 GMT
X-Varnish: 222744705
Age: 0
Via: 1.1 varnish
Connection: keep-alive


Need to find out who hosts Mullanpurplots.net?

Mullanpurplots.net Free SEO Report

Website Inpage Analysis for Mullanpurplots.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Mullanpurplots.net

mullanpur newfaqlikeproposedplots flatsnew chandigarh mullanpurmullanpur new chandigarhflatssqftampvaracresomaxechandigarhcitychandigarh mullanpurecopropertycommercialmullanpurseparatorapartmentscommercial propertynew chandigarhfloorsserviceyounewplots

Longtail Keyword Density for Mullanpurplots.net

KeywordsOccurences
mullanpur new chandigarh5
new chandigarh mullanpur4
new chandigarh9
mullanpur new6
chandigarh mullanpur4
commercial property3
plots flats3
mullanpur12
new10
chandigarh10
commercial7
flats6
omaxe6
property5
separator5
plots5
city4
sqft4
var3
amp3
proposed3
acres3
you3
floors3
apartments3
service3
faq3
like3
eco3

What are the nameservers for mullanpurplots.net?

Mullanpurplots.net Domain Nameserver Information

HostIP AddressCountry
ns01.one.com 195.206.121.10Denmark Denmark
ns02.one.com 195.206.121.138Denmark Denmark

Mullanpurplots.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Mullanpurplots.net is a scam?