Musd20.org  |  Maricopa USD ::
Low trust score  | 
Maricopa USD




Musd20.org Website Information

Website Ranks & Scores for Musd20.org

Statvoo Rank Statvoo Rank:I
Alexa Rank Alexa Rank:2,077,025
Majestic Rank Majestic Rank:0
Domain Authority Domain Authority:0%
DMOZ DMOZ Listing:No

Whois information for musd20.org

Full Whois Lookup for Musd20.org Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Musd20.org. Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Domain Name: MUSD20.ORG
Registry Domain ID: D7315698-LROR
Registrar WHOIS Server:
Registrar URL: http://www.networksolutions.com
Updated Date: 2017-06-13T20:55:39Z
Creation Date: 1999-06-17T18:17:01Z
Registry Expiry Date: 2027-06-17T18:17:40Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: C3136080-LROR
Registrant Name: Maricopa Unified School District 20
Registrant Organization: Maricopa Unified School District 20
Registrant Street: 45012 W HONEYCUTT AVE
Registrant City: Maricopa
Registrant State/Province: AZ
Registrant Postal Code: 85139-2842
Registrant Country: US
Registrant Phone: +1.5205685100
Registrant Phone Ext:
Registrant Fax: +1.9999999999
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C88311943-LROR
Admin Name: Jack Wallbrecht
Admin Organization: Maricopa Unified School District 20
Admin Street: 44150 W. Maricopa-Casa Grande Hwy
Admin City: Maricopa
Admin State/Province: AZ
Admin Postal Code: 85138
Admin Country: US
Admin Phone: +1.5205685100
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C88311943-LROR
Tech Name: Jack Wallbrecht
Tech Organization: Maricopa Unified School District 20
Tech Street: 44150 W. Maricopa-Casa Grande Hwy
Tech City: Maricopa
Tech State/Province: AZ
Tech Postal Code: 85138
Tech Country: US
Tech Phone: +1.5205685100
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Server: NS99.WORLDNIC.COM
Name Server: NS100.WORLDNIC.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-09-08T02:56:00Z

Who hosts Musd20.org?

Musd20.org is hosted by Hurricane Electric, Inc. in California, Fremont, United States, 94539.
Musd20.org has an IP Address of 209.51.164.169 and a hostname of samo4.pcmac.org.



Musd20.org Web Server Information

Hosted IP Address:209.51.164.169
Hosted Hostname:samo4.pcmac.org
Service Provider:Hurricane Electric, Inc.
Hosted Country:United StatesUS
Location Latitude:37.5497
Location Longitude:-121.9621
Webserver Software:Not Applicable

HTTP Header Analysis for Musd20.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Length: 44822
Content-Type: text/html; Charset=utf-8
Server: Microsoft-IIS/7.5
MicrosoftOfficeWebServer: 5.0_Pub
X-Powered-By: ASP.NET
Date: Sun, 10 Jan 2016 16:55:53 GMT


Need to find out who hosts Musd20.org?

Musd20.org Free SEO Report

Website Inpage Analysis for Musd20.org

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Musd20.org

servicesinformationnavloadnewsmiddlenavallstyledisplayvarnoneregistrationschoolschoolsnavdivstyledisplayelseresourcesasyncrequestnewdistrictblockfunctionmaricopaelementaryprogramampiflinksstudent

Longtail Keyword Density for Musd20.org

KeywordsOccurences
school9
function9
if7
information7
elementary7
var6
program6
maricopa5
block5
navallstyledisplay4
schools4
services4
none4
district4
else4
navload3
navdivstyledisplay3
asyncrequest3
resources3
amp3
middle3
student3
links3
news3
registration3
new3

What are the nameservers for musd20.org?

Musd20.org Domain Nameserver Information

HostIP AddressCountry
ns100.worldnic.com 207.204.21.150United States United States
ns99.worldnic.com 207.204.40.150United States United States

Musd20.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Musd20.org is a scam?