Muslim.or.id - Memurnikan Aqidah Menebarkan Sunnah

Safety: Low trust score
Year Founded: 2021
Global Traffic Rank: 177,242
Estimated Worth: $70,800

Website islami yang menyebarkan dakwah Islam Ahlussunnah wal jama’ah dengan slogan: "Memurnikan Aqidah, Menebarkan Sunnah"



Domain summary

Last updated
2021-11-15
Domain label
muslim
Domain extension
or.id
Global Traffic Rank
177,242
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$70,800
Estimated daily income
$118
Estimated monthly income
$3,589

Frequently Asked Questions (FAQ)

Q: When was Muslim.or.id registered?
A: Muslim.or.id was registered 1 week, 5 days, 3 hours, 3 minutes, 49 seconds ago on Monday, November 15, 2021.
Q: When was the WHOIS for Muslim.or.id last updated?
A: The WHOIS entry was last updated 1 week, 5 days, 3 hours, 3 minutes, 49 seconds ago on Monday, November 15, 2021.
Q: Who is the registrar for the Muslim.or.id domain?
A: The domain has been registered at .
Q: What is the traffic rank for Muslim.or.id?
A: Muslim.or.id ranks 177,242 globally on Alexa. Muslim.or.id has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Muslim.or.id each day?
A: Muslim.or.id receives approximately 9,433 visitors and 47,165 page impressions per day.
Q: What IP address does Muslim.or.id resolve to?
A: Muslim.or.id resolves to the IPv4 address .
Q: In what country are Muslim.or.id servers located in?
A: Muslim.or.id has servers located in the .
Q: What webserver software does Muslim.or.id use?
A: Muslim.or.id is powered by LiteSpeed webserver.
Q: Who hosts Muslim.or.id?
A: Muslim.or.id is hosted by Unknown in .
Q: How much is Muslim.or.id worth?
A: Muslim.or.id has an estimated worth of $70,800. An average daily income of approximately $118, which is roughly $3,589 per month.

Muslim.or.id Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Muslim.or.id Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Muslim.or.id

H1 Headings

0 :

H2 Headings

13 :
  1. Memurnikan Aqidah Menebarkan Sunnah
  2. Buku-Buku Dasar untuk Belajar Aqidah dan Tauhid
  3. Mana Bukti Cintamu pada Nabi?
  4. Apakah Jin Mengetahui Ilmu Gaib?
  5. Makna Islam Secara Umum dan Khusus
  6. Doa Terbaik untuk Anak Tercinta
  7. Semoga Dijauhkan dari Syubhat, Syahwat, dan Amarah
  8. Hukum Menebang Pohon yang Berbuah
  9. Apakah Iblis termasuk Golongan Malaikat ataukah Jin?
  10. Batasan Israf (Berlebih-lebihan) adalah ‘Urf
  11. Rincian Nama-Nama Malaikat dari Dalil Al-Qur’an dan As-Sunnah
  12. Berhukum dengan Selain Hukum Allah
  13. Mungkinkah Manusia Melihat Malaikat dalam Wujudnya yang Asli?

H3 Headings

5 :
  1. Aqidah
  2. Manhaj
  3. Fiqih dan Muamalah
  4. Akhlak dan Nasehat
  5. Donasi Operasional Website Muslim.or.id

H4 Headings

14 :
  1. Dukung Kami Di Facebook
  2. Channel YouTube Muslim.or.id
  3. Apakah Jin Mengetahui Ilmu Gaib?
  4. Makna Islam Secara Umum dan Khusus
  5. Apakah Iblis termasuk Golongan Malaikat ataukah Jin?
  6. Perbedaan antara Bid’ah dan Maksiat (Bag. 2)
  7. Perbedaan antara Bid’ah dan Maksiat (Bag. 1)
  8. Membahas Agama Tidak Boleh dengan Perkataan Cabul
  9. Syubhat Pelaku Riba “Daripada Miskin Lebih Baik Melakukan Riba”
  10. Hukum Mengucapkan Salam kepada Lawan Jenis
  11. Salah Kaprah: Jika Suami Meninggal, Semua Hartanya Jadi Milik Istri
  12. Semoga Dijauhkan dari Syubhat, Syahwat, dan Amarah
  13. Antara Dosa yang Diampuni dan Tidak Diampuni
  14. Mengapa Aku Sulit Bersyukur?

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

94 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-16598445-1

Links - Internal

104:

Keyword Cloud for Muslim.or.id

bidahdr raehanul bahraenmenjadihakimyulianaqidahumummuslimoridlainnyaalquranhukumanakpurnama skommfiqh dan muamalahfiqh danilmudan muamalahmengetahuisaifudin hakimpendidikan islamiblis termasukataukahulamafiqihnabijinpendidikan islam alatsarimuslimantararaehanul bahraendasarhakim mscyayasandakwahdariallahmscmalaikatypiadrislam alatsarim saifudin hakimm saifudinagamaphdyulian purnamatidakapakah iblis termasukmalaikat ataukahbahraen mscslidestoshowsaifudin hakim mscmsc sppkmanhajfunctionapakah iblisdengantentangtauhidsaifudiniblis termasuk golonganadasetiapadalahpohonyangbahraen msc sppkraehanul bahraen msckamimengetahui ilmutermasuk golongan malaikatnasehatkepadaraehanulfiqh0termasukmsc phddipendidikandr myulian purnama skomhakim msc phdmalaikat ataukah jinbahraengolongangolongan malaikat ataukahapakahdr m saifudintermasuk golonganataukah jindandoagolongan malaikatsppkpurnamamaknauntukdr raehanulislamiblismuamalahalatsarisyubhatdalamskomdan nasehat

Longtail Keyword Density for Muslim.or.id

KeywordsOccurences
dr m saifudin8
m saifudin hakim8
saifudin hakim msc8
hakim msc phd8
fiqh dan muamalah4
yulian purnama skom4
dr raehanul bahraen3
raehanul bahraen msc3
bahraen msc sppk3
apakah iblis termasuk3
iblis termasuk golongan3
termasuk golongan malaikat3
golongan malaikat ataukah3
malaikat ataukah jin3
pendidikan islam al-atsari3
dr m8
hakim msc8
m saifudin8
saifudin hakim8
msc phd8
dan muamalah5
purnama skom4
yulian purnama4
fiqh dan4
termasuk golongan3
pendidikan islam3
ataukah jin3
malaikat ataukah3
golongan malaikat3
dan nasehat3
iblis termasuk3
apakah iblis3
mengetahui ilmu3
msc sppk3
bahraen msc3
raehanul bahraen3
dr raehanul3
islam al-atsari3
dan30
yang16
islam12
msc12
dr12
m9
saifudin8
hakim8
phd8
muslim7
aqidah7
tentang7
malaikat7
jin6
adalah6
dari6
muslimorid6
apakah5
hukum5
muamalah5
dalam5
di5
ulama5
nasehat5
setiap4
dengan4
04
yulian4
purnama4
skom4
mengetahui4
function4
ilmu4
untuk4
allah4
fiqh4
kami4
ada4
lainnya4
agama4
al-quran4
kepada3
tidak3
bidah3
antara3
slidestoshow3
fiqih3
manhaj3
tauhid3
dakwah3
yayasan3
pendidikan3
ataukah3
pohon3
golongan3
termasuk3
iblis3
doa3
syubhat3
menjadi3
anak3
dasar3
raehanul3
umum3
makna3
bahraen3
sppk3
nabi3
ypia3
al-atsari3

Who hosts Muslim.or.id?

Muslim.or.id Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:LiteSpeed

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
Unknown
15.7989%
GOOGLE
14.3607%
AS-26496-GO-DADDY-COM-LLC
3.8534%
NAMECHEAP-NET
3.1479%
AMAZON-AES
2.3132%
GoDaddy.com, LLC
2.0763%
UNIFIEDLAYER-AS-1
1.9874%
Fara Negar Pardaz Khuzestan
1.6407%
CONFLUENCE-NETWORK-INC
1.4732%
1&1 Internet AG
1.3797%

HTTP Header Analysis for Muslim.or.id

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Connection: Keep-Alive
Last-Modified: Sun, 14 Nov 2021 23:00:43 GMT
Content-Type: text/html; charset=UTF-8
Cache-Control: public, max-age=0
Expires: Mon, 15 Nov 2021 00:08:28 GMT
Transfer-Encoding: chunked
Content-Encoding: gzip
Vary: Accept-Encoding,User-Agent,Accept-Encoding
Date: Mon, 15 Nov 2021 00:08:28 GMT
Server: LiteSpeed
Alt-Svc: quic=":443"; ma=2592000; v="43,46", h3-Q043=":443"; ma=2592000, h3-Q046=":443"; ma=2592000, h3-Q050=":443"; ma=2592000, h3-25=":443"; ma=2592000, h3-27=":443"; ma=2592000

Muslim.or.id Domain Nameserver Information

HostIP AddressCountry
UnknownUnknownUnknownUnknown


Need to find out who hosts Muslim.or.id?


Domain Registration (WhoIs) information for Muslim.or.id

Websites with Similar Names

Musli.de
musli.de steht zum Verkauf
Musli.nu
Gör din egen müsli - Musli.nu
Musli.shop
Сайт musli.shop не настроен на сервере
Musli2020.com
www.musli2020.com
Musli4u.com
ERRP | Expired Registration Recovery Policy
Musliadi.com
Error 404 (Not Found)!!1
Musliamss.com
musliamss.com

Recently Updated Websites

Bookstuff.net (9 seconds ago.)Dgyiyuan198.com (11 seconds ago.)Parkinsonsheating.com (12 seconds ago.)Greentechgmbh.de (13 seconds ago.)Havenhighacademy.net (16 seconds ago.)Gaggifting.com (17 seconds ago.)Gema-environnement.com (20 seconds ago.)Spanobang.com (21 seconds ago.)Freysingerhyundaicars.com (21 seconds ago.)Bestdealsonshopping.com (26 seconds ago.)Thebeatartist.com (28 seconds ago.)Cnnglobalnewsview.com (29 seconds ago.)Ergunlarsen.com (35 seconds ago.)Peronehive.com (37 seconds ago.)Pantuniestal.com (37 seconds ago.)Ak-mz.cz (38 seconds ago.)Carolynkanhar.com (39 seconds ago.)Market-ting.com (41 seconds ago.)Berrydonutvan.com (44 seconds ago.)Whereamihat.com (47 seconds ago.)Yasmineforunity.com (49 seconds ago.)Zxmedic.com (50 seconds ago.)Citizensclimatecleveland.org (51 seconds ago.)Audiobiblesdownload.com (51 seconds ago.)Redlipsglassart.net (52 seconds ago.)Solomoninsurancegroup.com (55 seconds ago.)Atspixel.com (58 seconds ago.)Piazzacafe.com (1 minute 1 second ago.)Gailpellettproductions.com (1 minute 1 second ago.)Jcartermusic.com (1 minute 2 seconds ago.)

Recently Searched Keywords

industri 40 (1 second ago.)dịch vụ vệ sinh công nghiệp (2 seconds ago.)janowitz (2 seconds ago.)压球机 (2 seconds ago.)eharmony for seniors (3 seconds ago.)乔布斯当年是这样面试我的,你能挺到哪一步? (3 seconds ago.)balados (4 seconds ago.)notruflotse (4 seconds ago.)neste markkinointi (5 seconds ago.)hs-custom-form optionsgetextrametadatabeforesubmit (6 seconds ago.)reedrelais (6 seconds ago.)follow @genius (7 seconds ago.)accedi ora. (8 seconds ago.)arriendo (8 seconds ago.)rund ums kind (9 seconds ago.)» zum tippschein (10 seconds ago.)dirtysoufyankee (12 seconds ago.)error occurred meaning in hindi (12 seconds ago.)папки для документов (13 seconds ago.)doos (14 seconds ago.)光大银行 (14 seconds ago.)set matchesurleventstennis1970324836986171-historical-matches-full-set-matchesweight0prematch0inplay13outright0topfalseregion (14 seconds ago.)windowheight var windowtopposition (14 seconds ago.)szkolenie bhp (15 seconds ago.)o museu (16 seconds ago.)scipy fft (17 seconds ago.)ml-form-embedpermissions (17 seconds ago.)experts (18 seconds ago.)male enhancement (18 seconds ago.)commercial-free (20 seconds ago.)