HOME | myfathershouse

Safety: Low trust score
Year Founded: 2016
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-11-26
Category: This site has not been categorized yet


Domain summary

Domain label
myfathershousect
Domain extension
org
Domain registered:
2016-08-04
Domain updated:
2020-11-26
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is myfathershousect.org ranked relative to other sites:

Percentage of visits to myfathershousect.org from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Myfathershousect.org registered?
A: Myfathershousect.org was registered 4 years, 5 months, 2 weeks, 2 days, 6 hours, 43 minutes, 46 seconds ago on Thursday, August 4, 2016.
Q: When was the WHOIS for Myfathershousect.org last updated?
A: The WHOIS entry was last updated 1 month, 3 weeks, 3 days, 6 hours, 43 minutes, 46 seconds ago on Thursday, November 26, 2020.
Q: What are Myfathershousect.org's nameservers?
A: DNS for Myfathershousect.org is provided by the following nameservers:
  • ns6.wixdns.net
  • ns7.wixdns.net
Q: Who is the registrar for the Myfathershousect.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Myfathershousect.org?
A: Myfathershousect.org has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Myfathershousect.org each day?
A: Myfathershousect.org receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Myfathershousect.org resolve to?
A: Myfathershousect.org resolves to the IPv4 address 23.236.62.147.
Q: In what country are Myfathershousect.org servers located in?
A: Myfathershousect.org has servers located in the United States.
Q: What webserver software does Myfathershousect.org use?
A: Myfathershousect.org is powered by Pepyaka/1.19.0 webserver.
Q: Who hosts Myfathershousect.org?
A: Myfathershousect.org is hosted by Google Inc. in California, Mountain View, United States, 94043.
Q: How much is Myfathershousect.org worth?
A: Myfathershousect.org has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Myfathershousect.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Myfathershousect.org Free SEO Report

Website Inpage Analysis for Myfathershousect.org

H1 Headings

0 :

H2 Headings

14 :
  1. An Anointed Renewal & Retreat Center
  2. 39 N Moodus Rd, Moodus, CT 06469  ph. 860-873-1906 
  3. Office hours: Tuesday-Friday 9:00a.m.-3:00p.m. Closed Mondays
  4. Thank you for your Easter offering!
  5. Upcoming Retreats & Events
  6. seminars
  7. Conferences
  8. teachings of the church
  9. guest speakers
  10. apologetics
  11. and more!
  12. Free eBook
  13. “I say to you, a son cannot do anything on his own, but only what he sees his father doing; for what he does, his son will also do.” –John 5:19
  14. FULL IMAGE

H3 Headings

0 :

H4 Headings

2 :
  1. Holy Spirit Gathering
  2. Every Thursday

H5 Headings

0 :

H6 Headings

13 :
  1. “Men of Galilee, why are you standing there looking at the sky? This Jesus who has been taken up from you into heaven will return in the same way as you have seen him going into heaven.”
  2. (Acts 1:11)
  3. Bird's eye view
  4. 39 N. Moodus Road
  5. Moodus, CT 06469
  6.  
  7. Where We Are
  8. Contact us
  9. Office Hours:Tuesday-Friday, 9am-3pm Closed Mondays
  10. Phone: 860-873-1906
  11. Email: [email protected]
  12. Follow Us

Total IFRAMEs

2 :

Total Images

27 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal (nofollow)

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Myfathershousect.org

if5px 5pxsanssansserif color0c3c60importantfontsize14pxcolor0c3c60selectdataerrortrue19margin0lineheightnormalletterspacingnormal body lrichtextcontainerpositionstaticboxshadow000 00 n05 1font normal normal1 10 borderrgba175display flexopen sanssansserif color0c3c60wordbreakbreakworddisplayinlineblocklineheight1animationduration 03spaddingbox borderbox 0selectfocuspositionabsolutetop0right0bottom0left0boxsizingborderbox importantbackgroundcolorrgba25518animationduration 03s animationtimingfunction0pxshqgiconleftimagebuttonwithtextsize32shqgiconleftimagebuttonwithtextbuttoneachopacity01nborderradius0 positionabsolutetop0right0bottom0left0backgroundcolorrgba14934px12em impactimpactw012010impactw022010impactw102010sansserif transitioncolorcubicbezier025 1 05164 202 10 0 053paginationnextwebkituserselectnonedisplayinlineblockmsuserselectnonewebkittouchcalloutnonepadding0pshqgiconleftimagebuttonwithtexttypelikeclickedshqgiconleftimagebuttonwithtextsize32shqgiconleftimagebuttonwithtextbuttonp margin0lineheightnormalletterspacingnormalstylej8osmsaknavcontainerjustifycontentflexend255 1 stylej8osmsaknavcontainer1borderstylesolidbordercolorrgba163 217 246border0px solid rgba218ecomvc1labelrgba51 51 51217 246 1transformationcontent204 204 1bordersolidoverflow hiddenborderstylesolidbordercolorrgba249 249cursor defaultlifirstoftype spanhorizontalmenusubmenu1642244324listwrappertransitionopacity 03s easeborder0237 255 1borderradius0heightcalc100unsetn1borderradius0 boxshadow0rgba0importantoverflowhiddencursorpointerwatai1datastateinvalidpaddingrightcenternnormal 34px12em impactimpactw012010impactw022010impactw102010sansserifdiv n transitionall 008sheight 100n width0 5px 5pxtextalignrightcursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpngleft20pxbackgroundposition0linear infinitetransition inheritshqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonlabel displaynonetransition all 008sborderboxnn display blocknntransparentstylablebutton643855516iconsanssansserif transitioncolor 04sopacity 03secomco1linknninfosvgtypeshapeviewbox0 0snkvktouchmediazoomimageinfo237 255 1borderradius5pxcontrollerparttype layoutchilddisplaydropdownbackgroundcolorrgba218spiritshqgiconleftimagebuttonwithtextbuttonlabel color000000calc100 980px 05positionabsolutetop0right0bottom0left0backgroundcolorrgba149 198 2360s colordaedff0px 0 0pxdisplayinlineblockpositionrelativesome more info255 02rgba227236 1borderradius0 positionabsolutetop0right0bottom0left0transitionbordercolor 04sheightcalc100 40pxtransitionbordercolor 04s easehas0px 0maxwidth 100normal 13px13em100 n transformsolid rgba57boxshadow 0153 232 1all 02srgba255 255contentpositionabsolutetextaligncenterbottom50left20pxwidth20pxheight20pxlineheight20pxul positionabsolutebottom10pxleft0right0textaligncentercolor0c3c60all 02s easestylejsanw9gk2linkright20pxbackgroundposition100204 1bordersolidshqgiconleftimagebuttonwithtextbuttontextwrapper255 255 092n heightspanboxshadow0 0 0heecomrfc1linkborder0px solidmargin0lineheightnormalletterspacingnormal headingopen sanssansserif transitioncolorcolor000000ahorizontalmenusubmenu1642244324listwrappermoreecomti1datastateinvalid8open sanssansserif04s ease 0sshqgiconleftimagebuttonwithtextsize36shqgiconleftimagebuttonwithtextbuttonul ul ul202 1body lrichtextcontainer1msliststyletypediscbackgroundcolorrgba255 255 2551bordercolorrgba12 60b3datastateshoulduseflexpositionrelativefffborderradius50boxshadow0 1px 3pxscrollstylej8osmsakrepeaterbuttonshade borderradius0 00pxdisplayinlineblockpositionrelative26boxsizingborderbox importantfontnormalease 0s colordaedffcaroljustifycontentborder1pxuldirrtl paddingright13emmarginright5em203 224227 227textaligninitialdisplayflexalignitemscenterboxhorizontalmenu2645433724menu nliststyletypesquarelineheightnormal bodyanimationtimingfunction cubicbezier025 1nnnwati1input1 pggcg0gallerydisplayerhovercursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur autooverflowhiddendisplayblockb3labelanimationnameabsoluten zindex008s cubicbezier025 1padding0 5pxdisplayinline importantfontsize14pxcolor0c3c60ul lifirstoftypecursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpngtextareafocusdisplaynoneanimationduration 03sn animationtimingfunctionnbspposition absolute zindexhiddenstylej8osmsakrepeaterbuttonshade borderradius00 rgba0pagg1opcpositionrelativewidth100height100wordwrapbreakwordpositionabsolutetop0right0bottom0left0transitionbordercolor 04s ease0s boxshadow0 1px249 1backgroundcolorrgba2551boxsizingborderboxbottomcubicbezier0251px rgba00s backgroundcolor 04s60 96ecomatc1labelwrapperpersonal1backgroundcolorrgba255 255 255pggcg0gallerydisplayervisible1bordersolid rgba12 60015sjustifycontentflexstart255 1h2solid rgba218stayboxshadow0lifirstoftype ahorizontalmenusubmenu1642244324listwrappertopstylej8osmsaknavcontainerarrowstylej8osmsaknavcontainerleftdirectionsolid 1pxease 0s opacity0borderradius0horizontalmenuheadingitem4038900883labelnorepeat paddingboxyourtextn controllerparttypeinset 0 005s96 1backgroundcolorrgba1751boxsizingborderbox importantborderradius0uldirrtl1 stylej8osmsaknavcontainer192 21160 96 10 0n nninfosvgtypeshapeviewbox0 0boxsizingborderboxborderradius0 positionabsolutetop0right0bottom0left0backgroundcolorrgba149 1980 rgba2550pxpositionrelativewhitespacenowrapshqgiconleftimagebuttonwithtextsize28shqgiconleftimagebuttonwithtextbuttonmenu itemhorizontalmenusubitem3001285389overflowbox div ntxtnew ulabsolute zindex 47sanssansserif0 0 6px255 1boxsizingborderboxn positioncontentpositionabsolutetextaligncenterbottom50left20pxwidth20pxheight20pxlineheight20px importantmarginbottom11pxcolorfffbackgroundf00border2px solidnorepeatmyshqgiconleftimagebuttonwithtextdirectionltrshqgiconleftimagebuttonwithtextsize32shqgiconleftimagebuttonwithtextbuttonstylej8osmsaknavcontainersvgcontainerpaddingright13emmarginright5em body lrichtextcontaineralignitems centernliststyletypesquarelineheightnormal susaawrichtextclickableskinrichtextcontainereveryopacity1margin 0cursor default importantpositionabsolutetop0right0bottom0left0borderradius5px transitionbordercolor 04sease 0s backgroundcolortransitionbordercolor 04s232 1paintboxnn3px rgba01backgroundcolorrgba255boxshadow 008s cubicbezier025contentpositionabsolutebottom12pxright10pxcolorffftextshadow0 1px 3pxborderwidth1px backgroundcolorrgba255 255normal 16px13em openboxsizing borderboxn1borderstylesolidbordercolorrgba163 217backgroundcolorrgba149textheadingbackgroundcolorrgba179flexshrink0 5pxopacity 03s cubicbezier025border 05s2px rgba249 249cursorpointer0 0 05fontsize12pxfontweightbold0 blacksnkvktouchmediazoomimageimagecontainerpafterstylej8osmsakrepeaterbuttonshadebackgroundcolorrgba12 60displaystylej8osmsaknavcontainerarrow stylej8osmsaknavcontainersvgcontainerrgba218div n246 1overflowhiddenborderwidth2px borderstylesolidbordercolorrgba249positionabsolutetop0right0bottom0left0borderradius5px transitionbordercolorboxshadownonergba255fffborderradius50boxshadow0app1inlinecontentbackgroundcolorrgba27dotted rgba12ecomatc1label1borderstylesolidbordercolorrgba163transitioncolor1px 3px rgba0liststyletypesquarelineheightnormaldisplay blocknn transitionexperience153 232positionabsolutebottom26pxwidth165pxheight26pxbackgroundurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseliftedshadowmediumpng7px 2pxcolorffftextshadow1px 1px100s border 05sbasedcontentpositionabsolutetextaligncenterbottom50left20pxwidth20pxheight20pxlineheight20px importantmarginbottom11pxcolorfffbackgroundf00border2pxbordercolor 008s cubicbezier025bordercolor 008sstylekgau1sxq1inputstylejsanw9gk2labelimportant1borderradius0default0 0 borderrgba175h4 margin0lineheightnormalletterspacingnormalimagebutton1datastatepressedinset 0008s cubicbezier0ecomco1labelwrapper3px rgba0 0opacity 0n0px 0px 0positionrelativewhitespacenowrappggcg2itemscontainerb1labelwrapper170s borderloving03snnormal normal 34px12em255 255 02ease 0stxtnew6px 0width 100n0n232 1bordercolorrgba12 60ease 0s boxshadow0spanhorizontalmenusubmenu1642244324listwrapper lifirstoftypeunsethorizontalmenusubmenu1642244324headinglifirstoftype spanhorizontalmenusubmenu1642244324listwrapper lifirstoftype03sn animationtimingfunctionimportantbackgroundcolorrgba255 255 255sc3bgarchetype paintboxnn boxsizingsolid rgba51ultxtnewsection ul lifirstoftypeshqgiconleftimagebuttonwithtextsize40shqgiconleftimagebuttonwithtextbuttonopacitynormal normal 13px13emheight 100positionabsolutetop0right0bottom0left0transitionbordercolor 04s1px 003s easeborderbox display blockcursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincurbody lrichtextcontainer olshqgiconleftimagebuttonwithtexttypelikeclickedshqgiconleftimagebuttonwithtextsize36shqgiconleftimagebuttonwithtextbuttonimportantmarginbottom11pxcolorfffbackgroundf00border2px solid fffborderradius50boxshadow0importantzindex50rgba57 114 155stylekgau1sxylabelborderrgba175rgba255 255 255connecticutbordercolorcontentpositionabsolutebottom50left3pxmargin0 0 7pxtbodymargin0lineheightnormalletterspacingnormal bodynn 100 ntransparent transparent50 50liststyletypecirclelineheightnormalautooverflowhiddendisplayblockimpactimpactw012010impactw022010impactw102010sansserif transitioncolorshqgiconleftimagebuttonwithtextdirectionltrshqgiconleftimagebuttonwithtextsize40shqgiconleftimagebuttonwithtextbuttonlayoutchilddisplaydropdownvirusborderradius0 fontnormalstylej8osmsaknavcontainerleftdirectioncontentpositionabsolutebottom50left3pxmargin0nn 100pggcg1itemscontainer249 249 1backgroundcolorrgba255cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcurecometi1inputhish5menustylekgau1sxylinksomeborderstylesolidbordercolorrgba249 249 249susaawrichtextclickableskinrichtextcontainermargin0lineheightnormalletterspacingnormal txtnew1transitionbackgroundcolor 04s easediv12iframe22li sectionstylej8osmsaknavcontainerarrowboxshadow 008spaddingbox borderboxsvgul ol1s255 2554pxshqgiconleftimagebuttonwithtextbuttonextrainfo displaynonenormal 13px13em openshqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonextrainfo displaynone1borderradius0 boxshadow0 1pxselectdatapreviewerror stylej8osmsaknavcontainerarrow0 053archetype paintbox boxsizing96 1 0px5px 01borderstylesolidbordercolorrgba255 255urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur autooverflowhiddendisplayblockwordbreaklilastoftypeboxsizingborderbox importantoverflowhiddencursorpointer important255 255 1borderradius0box display flex217 246255 1borderradius0imagebutton1datastatehoveredpaddingleft13emmarginleft5emlineheightnormalletterspacingnormalsutwetouchmediazoomitemimagecontainerul liststyletypesquarelineheightnormal bodypadding0 5pxdisplayinlinenormal normal 19px13embackgroundcolorrgba179 192 21150 50 repeatxbordersolid1px 1px rgba0study03s animationtimingfunction02display blocknnarchetype text controllerparttypehorizontalmenu2645433724menu li7px 2pxcolorffftextshadow1pxn transitionimportantbackgroundcolorrgba218 237 2552pxcolorffftextshadow1px 1px 3pxul ol uloverflowhiddenheight100right0borderwidth2px borderstylesolidbordercolorrgba249 2496importantleftautoborderboxtheirblockol ul liststyletypesquarelineheightnormalcontentpositionabsolutebottom50left3pxmargin0 0transitioncolor 04s easepaddingright13emmarginright5emimportantborderradius0 boxshadow0 0rgba227 227 227ecomvc1labelwrapperstylejqmqstx1borderwidth2px06opacity 008s cubicbezier0archetype textn controllerparttypetopautobottom01 solidshqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonlabelnonenwidth 100horizontalmenusubitem3001285389expandlefttranslatewidth100norepeat paddingbox borderbox100 widthecomrfc1labelwrapperimagebutton1defaultimage7rgba12 60oldirrtl0s colorcursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur auto96 1borderradius01pxurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseshiny1buttonbgpng 50 50backgroundcolorrgba204stylablehorizontalmenu4089050981menuitemarchetype textnwacb1249 1backgroundcolorrgba255 255ul liststyletypesquarelineheightnormal heading0 0 blackpositionabsolutetop0right0bottom0left0boxsizingborderboxyouborderradius0 0boxshadow0 00 3px rgba0008spositionfixed importantleftauto237 255noneheading srichtextcontainer0 inset rgba255selectdatapreviewerrorboxsizingborderbox importantbackgroundcolorrgba218 237imagebutton1activeimagebackgroundcolorrgba175 203n transition bordercolorwebkittransformul liststyletypesquarelineheightnormal susaawrichtextclickableskinrichtextcontainersectionb3link0 6px21oldirrtl paddingright13emmarginright5em2pxcolorffftextshadow1pxtheypositionabsolutebottom26pxwidth165pxheight26pxbackgroundurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseliftedshadowmediumpng norepeatpointereventsnonergba51 51cursor pointer0 0 5pxtaken13px13em open sanssansserifsusaawrichtextclickableskinrichtextcontainer olpositionabsolutetop0right0bottom0left0backgroundcolorrgba218horizontalmenu2645433724menu lilastoftypecontrollerparttype24housergba57body114 1551 0pxcursorpointer importantblocknn transitionshqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonlabel color000000us1px 4pxpaintboxnn boxsizing borderboxnndiv transition255 059box display0state of connecticutwebkitanimationnameshqgiconleftimagebuttonwithtextheartbeatanimationnameshqgiconleftimagebuttonwithtextheartbeatwebkitanimationduration05sanimationduration05s05 1 boxshadow02 0lrichtextcontainer oltextalignrightdirectionrtlanimationduration 03snnormal normal 16px13emarchetype texth1 margin0lineheightnormalletterspacingnormalshqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonextrainfo color000000backgroundcolorrgba255 255cursorimportantfontnormalposition absoluten zindexnormal 19px13em playsansserifpaintbox boxsizingh3 margin0lineheightnormalletterspacingnormalboxsizingborderbox importantbackgroundcolorrgba218also100n widthfathersapp1loadingbody lrichtextcontainerbody19px13em playsansserif13px13emsubmenutransitionopacity 05s easepaddingflex2n transition allimportantoverflowhiddencursorpointer importanttext controllerparttypeshqgiconleftimagebuttonwithtextbuttonicon left0ultxtnew ol1bordercolorrgba12100nb1labelflexwrap34px12em impactimpactw012010impactw022010impactw102010sansserifshqgiconleftimagebuttonwithtexttypelikeclickedshqgiconleftimagebuttonwithtextsize40shqgiconleftimagebuttonwithtextbuttondisplay flexnbackgroundcolorrgba204 204 204shqgiconleftimagebuttonwithtextbuttonlabel211 1borderstylesolidbordercolorrgba255borderradius0left0boxsizing borderbox displayborderradius0 0 5pxheight03sul0px 0px51 51tainputtextareabeen198 236pagg1rolloverholder0 0 06webkitkeyframesselectdatapreviewhoversusaawrichtextclickableskinrichtextcontainer ulgod164h1shqgiconleftimagebuttonwithtextbuttonicon right0positionabsolutetop0right0bottom0left0borderradius5pxtblc1varn archetype textnnormalmoodusroadboxshadow 0 0textalignleft importantfontnormal normalvisibilityanimationduration1ms linear infinite0pxcursorpointerpositionfixed importantleftauto importantzindex50wiximage positionabsolutetop0right0bottom0left0n overflowopacity 008s5px200 0 01514widthmaxwidthpositionstaticboxshadow000 0 0right96 1 0pxcursorpointerul liststyletypesquarelineheightnormalease15newinset rgba255 25504s ease6px03sn animationtimingfunction cubicbezier025pagg1buttons092transitioncolor 04srgba12 60 96backgroundcolor 04sbackgroundcolorrgba27 153 232100 width 100display block transitionfontnormalhorizontalmenusubmenu1642244324menuitem224 1 solidtextaligncentern 0 nmargin237 255 1backgroundcolorrgba121bordercolorrgba12 60 96left20pxbackgroundposition0 0rgba249 249n margintop255 1borderradius0 boxshadow0inheritli padding0normal 19px13emtransitionbordercolorminwidthhas beenshqgiconleftimagebuttonwithtextdirectionrtlshqgiconleftimagebuttonwithtextsize32shqgiconleftimagebuttonwithtextbuttonwiximage2px 5px rgba0n archetypeautoul paddingleft13emmarginleft5emlineheightnormalletterspacingnormalpointerevents40px importantsolid9pggcg3itemscontainern displayshqgiconleftimagebuttonwithtextbuttoniconfont normalstylej8osmsaknavcontainerarrowstylej8osmsaknavcontainercenterdirection2px rgba249marginrightborderradius0 positionabsolutetop0right0bottom0left0transitionbordercolorboxsizingmargintopplaysansserifbody lrichtextcontainer ulcolor 05s easeul positionabsolutebottom10pxleft0right0textaligncentercolor0c3c60 importantpggcg4itemscontainerboxsizingborderbox importantfontnormal normal1 solid 1px1borderstylesolidbordercolorrgba255all 008s cubicbezier0srichtextcontainer olbordercolor transparent7px0 0 rgba0srichtextcontainer ul255 1borderstylesolidbordercolorrgba163 217thursdayurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseshiny1buttonbgpng008s cubicbezier025archetype boxn displaybackgroundcolorrgba149 198 236archetype boxnstylablehorizontalmenu4089050981columnslayoutflexnhorizontalmenusubitem3001285389overflowboxstylej8osmsaknavcontainerrightdirectionborderwidth1px backgroundcolorrgba25503s cubicbezier025 1ol olpositionfixedposition absolutearchetype paintboxnn0positionrelativewhitespacenowrapimpactimpactw012010impactw022010impactw102010sansserifimportant heading srichtextcontainerheading1borderradius5px border0px04s203 224 1n n nninfosvgtypeshapeviewbox0nnpositionabsolutetop0right0bottom0left0backgroundcolorrgba218 23734px12emspanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3ltr horizontalmenu2645433724menu5px rgba01transitionbackgroundcolor 04sopenpaddingright13emmarginright5em heading srichtextcontainerposition absolutencolorblock transition inherit008s cubicbezier0 0animationtimingfunction cubicbezier025christmastransform1px rgba0 0boxn13borderradiusinheritspanbefore0 015importantmarginbottom11pxcolorfffbackgroundf00border2px solidimportantfontnormal normalborderboxnnpositionabsolutetop0right0bottom0left0backgroundcolorrgba149positionabsolutetop0right0bottom0left0boxsizingborderbox importantbackgroundcolorrgba255 255ol ol ulurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur auto1 0pxpositionabsolutetop0right0bottom0left0backgroundcolorrgba218 237 255980px 05pggcg0gallerydisplayerhoverimportant body lrichtextcontainerbodysome morescheduledstory1bordersolid rgba12text controllerparttype layoutchilddisplaydropdownrepeatxbordersolidselecthoverbackgroundcolorrgba27 153211 1borderstylesolidbordercolorrgba255 255left0px 0positionrelativewhitespacenowrap0 border1px solid1ms linear05fontsize12pxfontweightbold3px204 1bordersolid rgba12fonttransition opacity 03sol ul liststyletypecirclelineheightnormallifirstoftypebordersolidlrichtextcontainer ulecometi1erasep transitionopacity 05sourpositionabsolutetop0right0bottom0left0backgroundcolorrgba149 198div transition bordercolorrgba12backgroundcolor ffffff30pxcursorpointer importantsutwetouchmediazoomiteminfoimportantfontnormal normal normal16px13em open sanssansserifnotimpactimpactw012010impactw022010impactw102010sansserif transitioncolor 04sitemsbackgroundcolorrgba204 204n position absoluten50 repeatxbordersolidhorizontalmenuitem490841043containern display flexnanimationtimingfunction224 102s198 236 1n cursor defaulthavehorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollh6 margin0lineheightnormalletterspacingnormaln 0spanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtlautonheight 100nliststyletypesquarelineheightnormal heading srichtextcontainerhorizontalmenuitem490841043expandsubmenusolid rgba51 51ul liststyletypecirclelineheightnormalul ul1transitionbordercolor 04s19px13em1bordersolid980pxliststyletypesquarelineheightnormal headingease 0s bordersolidheight 100 width0sborderboxnn display192 211 1borderstylesolidbordercolorrgba255cubicbezier0 0 1borderrgba175 203stylej8osmsaknavcontainerarrowstylej8osmsaknavcontainerrightdirectionborderwidth1pximportantbackgroundcolorrgba218 237fontstyleinheritfontweightinheritlineheightinheritletterspacingnormaln cursor60 96 1borderradius0backgroundcolorrgba12 60 961backgroundcolorrgba255 255opacity0borderradius0backgroundcolor 04s ease1borderradius0 boxshadow0 0boxshadow0 1pxborder1px solidcontentpositionabsolutebottom12pxright10pxcolorffftextshadow0 1px13px13em openopen sanssansserif color0c3c60default importantarchetype paintboxrgba249 249 249colore4523fblackboxsizing borderboxnnshqgiconleftimagebuttonwithtextbuttonextrainfoback16px13embackgroundtransparentsolid rgba218 2370 borderrgba175 203borderwidth1px backgroundcolorrgba179spanhorizontalmenusubmenu1642244324listwrappernowrapimportantbackgroundcolorrgba218fathers housejustifycontent centerurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcurdaedff0 7px 2pxcolorffftextshadow1px0 border1px02s ease visibilityp transitionopacityboxshadow0 1px 4px0px 0px 0ease 0s border2505s 1ms0s backgroundcolormarginleft calc100 980px100 transformurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincursrichtextcontainermore inforgba218 237shqgiconleftimagebuttonwithtextbuttonextrainfo color000000paddingright13emmarginright5em bodyrgba218 237 2551bordersolid rgba255transition opacitypaddingright13emmarginright5em heading1px 1pxarchetype box displayoverflowul liststyletypedisc0 7px1boxsizingborderbox importantborderradius0 boxshadow0jesuscolor0c3c60dotted rgba12 60solid fffborderradius50boxshadow0zindex 47display blockabsolutenpaintbox boxsizing borderbox2pxabsolutecenter1 urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseshiny1buttonbgpngdoboxsizing borderboxnn display02s easechristmas carolcursorpointer importantffffffreadersshqgiconleftimagebuttonwithtextdirectionrtlshqgiconleftimagebuttonwithtextsize28shqgiconleftimagebuttonwithtextbutton100 neveryone114px rgba0 0my fathersli section ulhorizontalmenuitem490841043labelbackgroundcolorborderbox 0ol ultransitionopacity 05s4px rgba0padding01 05position0s boxshadow0cubicbezier0insetstateimagebutton1hoverimagebackgroundcolorrgba218 237 255h2 margin0lineheightnormalletterspacingnormalpositionabsolutetop0right0bottom0left0transitionbordercolor1px 3pxselectdatapreviewfocusol1px 0 0shqgiconleftimagebuttonwithtextdirectionrtlshqgiconleftimagebuttonwithtextsize36shqgiconleftimagebuttonwithtextbuttonborder0pxb3labelwrapperlrichtextcontainerpafter contentpositionabsolutebottom12pxright10pxcolorffftextshadow0 1pxcolore4523f importantboxshadowsolid fffborderradius50boxshadow0 1pxbibleheading srichtextcontainer olmargintop0shqgiconleftimagebuttonwithtextbuttonlabel displaynoneheightcalc100 40px importantflexgrow0 rgba0 0h41transitionbackgroundcolorpagg1autoplaytextalignjustify232 1bordercolorrgba12positionstaticboxshadow000b3datadisabledtruefffborderradius50boxshadow0 1pxno1borderradius5px border0px solidpaddingright13emmarginright5em susaawrichtextclickableskinrichtextcontainerborder40pxitemease 0s colorplaysansserif color0c3c60transitionopacity 03ssnkvktouchmediazoomcentereddivhorizontalmenu2645433724menu27dayspanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtl horizontalmenu2645433724menu0 1li fontstyleinheritfontweightinheritlineheightinheritletterspacingnormalcalc100 980px16px13em opencolor 05ssrichtextcontainerheadingimportantmarginbottom11pxcolorfffbackgroundf00border2pxwhitespacenormal10pxtransitionopacityb3datadisabledfalseactivedatastatemobile05s easeliststyletypedecimalahorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtl horizontalmenu2645433724menuurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseshiny1buttonbgpng 50lrichtextcontainerbodydisplayblockoverflowhidden0 3pxtextaligncenter importantalignitems centern archetype paintboxnnarchetypeinfiniteanyshqgiconleftimagebuttonwithtextbuttonicon webkitanimationnameshqgiconleftimagebuttonwithtextheartbeatanimationnameshqgiconleftimagebuttonwithtextheartbeatwebkitanimationduration05sanimationduration05sborderboxn0c3c605px rgba0 0margin0lineheightnormalletterspacingnormaldiv animationnamepositionabsolutetop0right0bottom0left0borderrgba175 203 2240 1px255 1borderstylesolidbordercolorrgba163borderradius0 fontnormal normal1transitionbordercolorgroup0 0pxdisplayinlineblockpositionrelativesanssansserif color0c3c60wordbreakbreakworddisplayinlineblocklineheight1opacity0 imagebutton1datastatepressednormal 16px13emstylejsanw9gk2labelwrapperblock transitionshqgiconleftimagebuttonwithtextdirectionltrshqgiconleftimagebuttonwithtextsize36shqgiconleftimagebuttonwithtextbuttonhorizontalmenusubitem3001285389labelcolor0c3c60wordbreakbreakworddisplayinlineblocklineheight1tblc1 tbodyn animationname0s color 05slb1itemscontainerboxn displaydotted39729bshqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonextrainfoshqgiconleftimagebuttonwithtexttypelikeclickedshqgiconleftimagebuttonwithtextsize28shqgiconleftimagebuttonwithtextbuttonecomatc1link0 5px 0stylej8osmsakrepeaterbuttonlabelborderstylesolidbordercolorrgba249intoimportantbackgroundcolorrgba255 2551px 4px rgba0heading srichtextcontainer ulnormal 34px12emimportant headingsvg nrgba0 0safetyhorizontalmenuitem490841043overflowboxecomvc1link053backgroundcolorrgba179 192tdhorizontalmenuitem490841043overflowbox divlinearborderradius2px0 1px 01 boxshadowjustifycontentcenterarchetype boxlife1borderstylesolidbordercolorrgba255 255 255rgba57 114paintboxtransitionwatai1horizontalmenusubitem3001285389expandrighttranslatepaddingboximportant bodymassspan whitespacenormalli padding0 5pxdisplayinlinealignitemssolid rgba57 114importantborderradius02px 5px0 0 border1pxtransition allease visibilityborderbox displayhorizontalmenuitem490841043overflowbox div nol ul ulstylej8osmsaknavcontainercenterdirectionborderwidth1px backgroundcolorrgba179 192app1datastateloading204 2041 0pxcursorpointercolordaedffboxshadow0 1px 1pxtextalignjustify importantnormal normal05s 1ms linearabsolute zindex03s cubicbezier025059rgba0 0 0selectkeyframesh5 margin0lineheightnormalletterspacingnormalbackgroundcolorrgba149 198allmargintop 0importantborderradius0 boxshadow0border1px solid rgba515153 232 1bordercolorrgba12backgroundcolorrgba175 203 2240 n transformhiddenncolumnsnormal normal normalrgba2490 transformlistylekgau1sxylabelwrapper1 boxshadow 008smarginleftshqgiconleftimagebuttonwithtextdirectionltrshqgiconleftimagebuttonwithtextsize28shqgiconleftimagebuttonwithtextbutton0 importantinset rgba255000000015fontnormal normal normalpositionabsolutebottom10pxleft0right0textaligncentercolor0c3c60h6inheritn1borderradius5pxmargin0lineheightnormalletterspacingnormal heading srichtextcontainerheading srichtextcontainerheading03s ease 0s255 092importantbackgroundcolorrgba255spanhorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3ltr0 insetcubicbezier0 00 6px 0displayblockboxshadow0 0 3px0 rgba255 255n nninfosvgtypeshapeviewbox0textalignleft05s ease 0sdiv n animationname2pxcolorffftextshadow1px 1px255 1borderradius5px border0px1transitionbordercolor 04s easesanssansserif transitioncolor255 1borderradius5px0 05fontsize12pxfontweightboldmargin0positionabsolutebottom10pxleft0right0textaligncentercolor0c3c60 importantcubicbezier025 1zindexcolor ffffffn transform0s opacity0borderradius0pointerevents nonenorepeatpointereventsnonetextalignright importantbackgroundcolorrgba2551 urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseshiny1buttonbgpng 50ul ul liststyletypesquarelineheightnormal0s bordersolid05liststyletypesquarelineheightnormal body lrichtextcontainerspanbefore contentahorizontalmenu2645433724roothorizontalmenu2645433724menumode6scrollhorizontalmenu2645433724direction3rtl255 255 1marginleft calc100boxsizingborderbox importantoverflowhiddencursorpointerb1linkwhitespacepafter contentpositionabsolutebottom12pxright10pxcolorffftextshadow0255 255 059my fathers housewe0 0 05pxdisplayinline importantfontsize14pxcolor0c3c60avoidol liststyletypedecimalboxsizing borderbox249 249border 05s ease1 05 123horizontalmenusubitem3001285389overflowbox divbackgroundcolorrgba218 237paintboxnn boxsizing5pxdisplayinlinetransition bordercolor 008stransition bordercolornninfosvgtypeshapeviewbox0textnbackgroundcolorffffffn archetype boxnimportantleftauto importantzindex50255 255 1borderstylesolidbordercolorrgba163blocknn100n width 100nrgba510 06h3nowrapninfo0 1 1rgba227 227margin0lineheightnormalletterspacingnormal susaawrichtextclickableskinrichtextcontainersection ulpointerhorizontalmenu2645433724menu lifirstoftypen nshqgiconleftimagebuttonwithtextdirectionrtlshqgiconleftimagebuttonwithtextsize40shqgiconleftimagebuttonwithtextbuttonul ul liststyletypecirclelineheightnormalcalc100transition opacity 008simportantheight100contentpositionabsolutebottom12pxright10pxcolorffftextshadow0164 202103s animationtimingfunction cubicbezier025

Longtail Keyword Density for Myfathershousect.org

KeywordsOccurences
04s ease 0s73
rgba0 0 053
0 0 027
cubic-bezier025 1 0526
fontnormal normal normal24
background-color 04s ease22
0s background-color 04s22
ease 0s background-color22
3px rgba0 021
60 96 120
05s ease 0s18
rgba12 60 9618
1px 3px rgba018
1 05 117
background-colorrgba255 255 25516
positionstaticbox-shadow000 0 016
008s cubic-bezier025 116
transitioncolor 04s ease16
margin-left calc100 980px16
calc100 980px 0516
normal normal 13px13em15
13px13em open sanssans-serif15
normal 13px13em open15
217 246 114
255 255 114
shqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonlabel color00000012
0 rgba0 012
008s cubic-bezier0 012
cubic-bezier0 0 112
rgba255 255 25512
shqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonextrainfo color00000012
203 224 111
font normal normal11
0 0 0611
1border-stylesolidborder-colorrgba163 217 24610
255 1border-stylesolidborder-colorrgba163 21710
255 255 1border-stylesolidborder-colorrgba16310
1bordersolid rgba12 6010
border-width1px background-colorrgba255 25510
0 0 rgba010
background-colorrgba204 204 20410
normal normal normal9
96 1 0px9
box-shadow0 0 09
box-shadow 008s cubic-bezier0258
transition all 008s8
4px rgba0 08
1px 4px rgba08
box-shadow0 1px 4px8
1 box-shadow 008s8
05 1 box-shadow8
border-color 008s cubic-bezier0258
background-colorrgba179 192 2118
transition border-color 008s8
all 008s cubic-bezier08
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur autooverflowhiddendisplayblock7
some more info7
background-colorrgba218 237 2557
237 255 17
normal normal 16px13em7
204 204 1bordersolid7
margin0line-heightnormalletter-spacingnormal body lrichtextcontainer7
transitionborder-color 04s ease7
normal 16px13em open7
16px13em open sanssans-serif7
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur auto7
margin0line-heightnormalletter-spacingnormal heading srichtextcontainer7
ol ul list-style-typesquareline-heightnormal6
ul ul list-style-typesquareline-heightnormal6
open sanssans-serif transitioncolor6
204 1bordersolid rgba126
255 1border-radius0 box-shadow06
sanssans-serif transitioncolor 04s6
0 1 16
1 solid 1px6
224 1 solid6
borderrgba175 203 2246
background-colorrgba149 198 2366
ease 0s box-shadow06
255 255 1border-radius06
0s box-shadow0 1px6
0px 0 0pxdisplayinline-blockpositionrelative6
n -archetype boxn6
fffborder-radius50box-shadow0 1px 3px6
background-colorrgba12 60 966
solid fffborder-radius50box-shadow0 1px6
animation-timing-function cubic-bezier025 16
1border-radius0 box-shadow0 1px5
color 05s ease5
0s color 05s5
249 249 1background-colorrgba2555
1px 1px rgba05
249 1background-colorrgba255 2555
211 1border-stylesolidborder-colorrgba255 2555
solid rgba218 2375
rgba218 237 2555
1background-colorrgba255 255 2555
inset 0 05
0 0 05font-size12pxfont-weightbold5
1transitionborder-color 04s ease5
1px rgba0 05
1border-stylesolidborder-colorrgba255 255 2555
background-colorrgba27 153 2325
transitionopacity 05s ease5
n display flexn5
horizontalmenusubitem3001285389overflowbox div n5
background-colorrgba175 203 2245
0s border 05s5
li padding0 5pxdisplayinline5
border-width1px background-colorrgba179 1925
192 211 1border-stylesolidborder-colorrgba2555
padding0 5pxdisplayinline importantfont-size14pxcolor0c3c605
153 232 15
border 05s ease5
ease 0s border5
ease 0s color5
open sanssans-serif color0c3c604
shqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonextrainfo displaynone4
normal 19px13em playsans-serif4
0 rgba255 2554
198 236 14
-2pxcolorffftext-shadow1px 1px 3px4
positionabsolutetop0right0bottom0left0transitionborder-color 04s ease4
03s ease 0s4
heightcalc100 40px important4
ease 0s bordersolid4
0px 0px 04
ul positionabsolutebottom10pxleft0right0text-aligncentercolor0c3c60 important4
normal normal 19px13em4
transitionopacity 03s ease4
0 0 borderrgba1754
-7px -2pxcolorffftext-shadow1px 1px4
0 borderrgba175 2034
2px rgba249 2494
rgba249 249 2494
0 0 0154
positionabsolutetop0right0bottom0left0background-colorrgba218 237 2554
shqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonlabel displaynone4
importantmargin-bottom-11pxcolorfffbackgroundf00border2px solid fffborder-radius50box-shadow04
0 -7px -2pxcolorffftext-shadow1px4
1 0pxcursorpointer important4
box-shadow 0 04
0 0 black4
border-width2px border-stylesolidborder-colorrgba249 2494
list-style-typesquareline-heightnormal body lrichtextcontainer4
transition opacity 03s4
ol ol ul4
ol ul ul4
n transition all4
n position absoluten4
positionfixed importantleftauto importantz-index504
opacity 03s cubic-bezier0254
03s cubic-bezier025 14
border-stylesolidborder-colorrgba249 249 2494
0 5px 5px4
0 inset rgba2554
padding-box border-box 04
no-repeat padding-box border-box4
section ul lifirst-of-type4
li section ul4
lifirst-of-type spanhorizontalmenusubmenu1642244324listwrapper lifirst-of-type4
02s ease visibility4
all 02s ease4
n -archetype textn4
-archetype textn -controller-part-type4
text -controller-part-type layoutchilddisplaydropdown4
-archetype text -controller-part-type4
opacity 008s cubic-bezier04
body lrichtextcontainer ol4
inset rgba255 2554
normal 34px12em impactimpact-w01-2010impact-w02-2010impact-w10-2010sans-serif4
1ms linear infinite4
05s 1ms linear4
ul list-style-typesquareline-heightnormal susaawrichtextclickableskinrichtextcontainer4
state of connecticut4
normal normal 34px12em4
transition opacity 008s4
heading srichtextcontainer ul4
heading srichtextcontainer ol4
ul list-style-typesquareline-heightnormal body4
body lrichtextcontainer ul4
list-style-typesquareline-heightnormal heading srichtextcontainer4
ul list-style-typesquareline-heightnormal heading4
animation-duration 03sn animation-timing-function3
-archetype boxn display3
box-shadow0 0 3px3
ease 0s opacity0border-radius03
my fathers house3
n n nninfosvgtypeshapeviewbox03
height 100n width3
pafter contentpositionabsolutebottom-12pxright10pxcolorffftext-shadow0 1px3
contentpositionabsolutebottom-12pxright10pxcolorffftext-shadow0 1px 3px3
box-sizingborder-box importantfontnormal normal3
03sn animation-timing-function cubic-bezier0253
0 3px rgba03
importantfontnormal normal normal3
div n animation-name3
n -archetype paintboxnn3
-archetype paintboxnn box-sizing3
1border-radius0 box-shadow0 03
paintboxnn box-sizing border-boxnn3
237 255 1border-radius03
box-sizing border-boxnn display3
importantbackground-colorrgba218 237 2553
box-sizingborder-box importantbackground-colorrgba218 2373
box-sizingborder-box importantoverflowhiddencursorpointer important3
border-boxnn display blocknn3
100 n transform3
n transition border-color3
n cursor default3
nn 100 n3
0 n transform3
n 0 n3
1box-sizingborder-box importantborder-radius0 box-shadow03
importantborder-radius0 box-shadow0 03
position absoluten z-index3
horizontalmenuitem490841043overflowbox div n3
div n transition3
n nninfosvgtypeshapeviewbox0 03
display blocknn transition3
border1px solid rgba513
p transitionopacity 05s3
0 0 5px3
0 0 6px3
0 6px 03
255 255 0923
0 1px 03
1px 0 03
255 255 023
0 5px 03
0 0 0533
ul ul list-style-typecircleline-heightnormal3
ol ul list-style-typecircleline-heightnormal3
ul ol ul3
ul ul ul3
absolute z-index 473
important heading srichtextcontainerheading3
padding-right13emmargin-right5em heading srichtextcontainer3
255 255 0593
5px rgba0 03
padding-right13emmargin-right5em body lrichtextcontainer3
164 202 13
03s animation-timing-function cubic-bezier0253
-archetype box display3
box display flex3
height 100 width3
100 width 1003
60 96 1border-radius03
255 1 style-j8osmsaknavcontainer3
open sanssans-serif color0c3c60word-breakbreak-worddisplayinline-blockline-height13
2px 5px rgba03
div transition border-color3
1transitionbackground-color 04s ease3
style-j8osmsakrepeaterbuttonshade border-radius0 03
border-radius0 0 5px3
dotted rgba12 603
solid rgba57 1143
rgba57 114 1553
important body lrichtextcontainerbody3
positionabsolutetop0right0bottom0left0border-radius5px transitionborder-color 04s3
-archetype paintbox box-sizing3
block transition inherit3
0px 0px 0positionrelativewhite-spacenowrap3
96 1 0pxcursorpointer3
153 232 1border-colorrgba123
232 1border-colorrgba12 603
1border-colorrgba12 60 963
border-radius0 positionabsolutetop0right0bottom0left0background-colorrgba149 1983
positionabsolutetop0right0bottom0left0background-colorrgba149 198 2363
display block transition3
34px12em impactimpact-w01-2010impact-w02-2010impact-w10-2010sans-serif transitioncolor3
border-box display block3
box-sizing border-box display3
contentpositionabsolutetext-aligncenterbottom50left-20pxwidth20pxheight20pxline-height20px importantmargin-bottom-11pxcolorfffbackgroundf00border2px solid3
contentpositionabsolutebottom50left3pxmargin0 0 -7px3
rgba227 227 2273
paintbox box-sizing border-box3
border-radius0 fontnormal normal3
impactimpact-w01-2010impact-w02-2010impact-w10-2010sans-serif transitioncolor 04s3
border-radius0 positionabsolutetop0right0bottom0left0transitionborder-color 04s3
position absolute z-index3
1border-radius5px border0px solid3
1 urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseshiny1buttonbgpng 503
urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseshiny1buttonbgpng 50 503
50 50 repeat-xbordersolid3
ease 0s colordaedff3
cursor default important3
237 255 1border-radius5px3
255 1border-radius5px border0px3
border0px solid rgba2183
rgba51 51 513
positionabsolutetop0right0bottom0left0box-sizingborder-box importantbackground-colorrgba255 2553
importantbackground-colorrgba255 255 2553
box-shadow0 1px 1px3
0 0 border1px3
0 border1px solid3
animation-duration 03s animation-timing-function3
solid rgba51 513
100n width 100n3
0 0130
ease 0s96
04s ease78
255 25554
rgba0 053
normal normal49
60 9635
cubic-bezier025 126
1 0526
fontnormal normal25
shqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonextrainfo24
open sanssans-serif24
shqgiconleftimagebuttonwithtextbuttontextwrapper shqgiconleftimagebuttonwithtextbuttonlabel24
0s background-color22
background-color 04s22
255 121
3px rgba021
heading srichtextcontainer21
body lrichtextcontainer21
96 120
237 25519
n -archetype18
rgba12 6018
1px 3px18
05s ease18
05 117
positionstaticbox-shadow000 016
transitioncolor 04s16
margin-left calc10016
calc100 980px16
980px 0516
008s cubic-bezier02516
background-colorrgba255 25516
normal 13px13em15
ol ul15
203 22415
13px13em open15
246 114
217 24614
204 20414
ul ul14
box-sizing border-box13
1 0px13
cursorpointer important13
box-shadow0 012
ul list-style-typesquareline-heightnormal12
rgba255 25512
0 rgba012
shqgiconleftimagebuttonwithtextbuttonextrainfo color00000012
008s cubic-bezier012
198 23612
display flex12
0 112
shqgiconleftimagebuttonwithtextbuttonlabel color00000012
cubic-bezier0 012
0 0611
box-shadow0 1px11
224 111
font normal11
192 21111
transition all10
spanbefore content10
border-width1px background-colorrgba25510
255 1border-stylesolidborder-colorrgba16310
1border-stylesolidborder-colorrgba163 21710
1bordersolid rgba1210
background-colorrgba204 20410
horizontalmenusubitem3001285389overflowbox div10
display flexn9
div n9
n transition9
0pxcursorpointer important9
255 1border-radius09
153 2329
227 2279
horizontalmenu2645433724menu lilast-of-type8
all 008s8
border-color 008s8
transition border-color8
249 2498
1 box-shadow8
horizontalmenu2645433724menu lifirst-of-type8
0px 0px8
box-shadow 008s8
1 solid8
-controller-part-type layoutchilddisplaydropdown8
transition opacity8
ul lifirst-of-type8
height 1008
4px rgba08
1px 4px8
background-colorrgba179 1928
n display8
1border-radius0 box-shadow08
114 1557
1px 1px7
cursor default7
urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur autooverflowhiddendisplayblock7
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur7
border1px solid7
204 1bordersolid7
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpng urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur7
transitionborder-color 04s7
urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur auto7
margin0line-heightnormalletter-spacingnormal susaawrichtextclickableskinrichtextcontainer7
transition inherit7
some more7
background-colorrgba218 2377
more info7
n transform7
margin0line-heightnormalletter-spacingnormal body7
0 5px7
margin0line-heightnormalletter-spacingnormal heading7
16px13em open7
normal 16px13em7
margin0line-heightnormalletter-spacingnormal txtnew7
uldirrtl padding-right13emmargin-right5em6
ul list-style-typecircleline-heightnormal6
n position6
-archetype boxn6
0s box-shadow06
sanssans-serif transitioncolor6
-archetype box6
background-colorrgba12 606
1 16
horizontalmenuitem490841043overflowbox div6
animation-timing-function cubic-bezier0256
borderrgba175 2036
solid 1px6
li section6
inset 06
0 1px6
solid fffborder-radius50box-shadow06
0 0pxdisplayinline-blockpositionrelative6
0px 06
fffborder-radius50box-shadow0 1px6
background-colorrgba149 1986
overflow hidden6
pointer-events none6
1ms linear6
1transitionborder-color 04s5
transitionopacity 05s5
rgba218 2375
padding0 5pxdisplayinline5
li padding05
height 100n5
ul positionabsolutebottom10pxleft0right0text-aligncentercolor0c3c605
background-colorrgba175 2035
color 05s5
0s color5
border 05s5
0s border5
solid rgba2185
211 1border-stylesolidborder-colorrgba2555
232 15
1border-stylesolidborder-colorrgba255 2555
background-colorrgba27 1535
0 -7px5
0 05font-size12pxfont-weightbold5
box-sizing border-boxnn5
lrichtextcontainer ul5
tblc1 tbody5
left-20pxbackground-position0 05
border-width1px background-colorrgba1795
1px rgba05
5pxdisplayinline importantfont-size14pxcolor0c3c605
colore4523f important5
srichtextcontainer ul5
249 1background-colorrgba2555
style-j8osmsakrepeaterbuttonshade border-radius05
1background-colorrgba255 2555
-archetype text5
1 style-j8osmsaknavcontainer5
164 2025
position absolute5
0 3px5
1box-sizingborder-box importantborder-radius04
box-shadow 04
border-stylesolidborder-colorrgba249 2494
fathers house4
all 02s4
positionabsolutetop0right0bottom0left0transitionborder-color 04s4
0 black4
max-width 1004
width 1004
border-width2px border-stylesolidborder-colorrgba2494
shqgiconleftimagebuttonwithtextbuttonextrainfo displaynone4
opacity 03s4
03s cubic-bezier0254
shqgiconleftimagebuttonwithtextbuttonlabel displaynone4
transitionopacity 03s4
03s ease4
heightcalc100 40px4
40px important4
background-color ffffff4
shqgiconleftimagebuttonwithtextbuttonicon -webkit-animation-nameshqgiconleftimagebuttonwithtextheartbeatanimation-nameshqgiconleftimagebuttonwithtextheartbeat-webkit-animation-duration05sanimation-duration05s4
1 0pxcursorpointer4
02s ease4
5px 5px4
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-ltr horizontalmenu2645433724menu4
lifirst-of-type ahorizontalmenusubmenu1642244324listwrapper4
section ul4
margin-top 04
0 inset4
0 rgba2554
-2pxcolorffftext-shadow1px 1px4
-7px -2pxcolorffftext-shadow1px4
lifirst-of-type spanhorizontalmenusubmenu1642244324listwrapper4
menu item4
horizontalmenu2645433724menu li4
importantmargin-bottom-11pxcolorfffbackgroundf00border2px solid4
ahorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl horizontalmenu2645433724menu4
align-items center4
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl horizontalmenu2645433724menu4
rgba249 2494
2px rgba2494
no-repeat padding-box4
padding-box border-box4
0s bordersolid4
border-box 04
1 urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseshiny1buttonbgpng4
margin 04
opacity 008s4
display block4
ease visibility4
shqgiconleftimagebuttonwithtextbuttonicon right04
positionabsolutetop0right0bottom0left0background-colorrgba218 2374
positionfixed importantleftauto4
susaawrichtextclickableskinrichtextcontainer ul4
heading srichtextcontainerheading4
h1 margin0line-heightnormalletter-spacingnormal4
h2 margin0line-heightnormalletter-spacingnormal4
h3 margin0line-heightnormalletter-spacingnormal4
h4 margin0line-heightnormalletter-spacingnormal4
h5 margin0line-heightnormalletter-spacingnormal4
h6 margin0line-heightnormalletter-spacingnormal4
list-style-typesquareline-heightnormal susaawrichtextclickableskinrichtextcontainer4
34px12em impactimpact-w01-2010impact-w02-2010impact-w10-2010sans-serif4
-archetype textn4
susaawrichtextclickableskinrichtextcontainer ol4
textn -controller-part-type4
p margin0line-heightnormalletter-spacingnormal4
236 14
0 0154
linear infinite4
05s 1ms4
width 100n4
normal 34px12em4
box-sizing border-boxn4
playsans-serif color0c3c604
span white-spacenormal4
1px 04
0 borderrgba1754
inset rgba2554
important heading4
ol ol4
normal 19px13em4
text-alignjustify important4
importantleftauto importantz-index504
n cursor4
color ffffff4
sanssans-serif color0c3c604
position absoluten4
text-alignleft important4
text-alignright important4
positionabsolutebottom10pxleft0right0text-aligncentercolor0c3c60 important4
n overflow4
19px13em playsans-serif4
text-aligncenter important4
li font-styleinheritfont-weightinheritline-heightinheritletter-spacingnormal4
txtnew ul4
ol list-style-typedecimal4
srichtextcontainer ol4
list-style-typesquareline-heightnormal heading4
ul ol4
body lrichtextcontainerbody4
important body4
shqgiconleftimagebuttonwithtextbuttonicon left04
lrichtextcontainer ol4
list-style-typesquareline-heightnormal body4
ul list-style-typedisc4
text -controller-part-type4
spanhorizontalmenusubmenu1642244324listwrapper lifirst-of-type4
opacity 03
div transition3
border-color transparent3
importantborder-radius0 box-shadow03
opacity0 imagebutton1data-statepressed3
6px 03
1bordersolid rgba2553
animation-duration 03sn3
paintboxnn box-sizing3
border-boxnn display3
display blocknn3
blocknn transition3
absoluten z-index3
n animation-name3
03sn animation-timing-function3
0 transform3
boxn display3
align-items centern3
svg n3
100n width3
n margin-top3
horizontalmenu2645433724menu n3
-archetype paintboxnn3
100 n3
z-index 473
has been3
absolute z-index3
default important3
block transition3
border-box display3
my fathers3
christmas carol3
n nninfosvgtypeshapeviewbox03
nn 1003
nninfosvgtypeshapeviewbox0 03
paintbox box-sizing3
-archetype paintbox3
n 03
0 n3
100 transform3
n n3
rgba227 2273
div animation-name3
255 1border-radius5px3
50 repeat-xbordersolid3
wix-image positionabsolutetop0right0bottom0left03
rgba57 1143
0s colordaedff3
solid rgba573
dotted rgba123
1border-radius5px border0px3
urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseshiny1buttonbgpng 503
border0px solid3
border-radius0 03
positionabsolutebottom-26pxwidth165pxheight26pxbackgroundurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseliftedshadowmediumpng no-repeatpointer-eventsnone3
1transitionbackground-color 04s3
positionabsolutetop0right0bottom0left0box-sizingborder-box importantbackground-colorrgba2553
importantbackground-colorrgba255 2553
50 503
positionabsolutetop0right0bottom0left0border-radius5px transitionborder-color3
selectdata-previewerror style-j8osmsaknavcontainerarrow3
transparent transparent3
0 6px3
255 0923
255 023
02 03
5px 03
255 0593
ul padding-left13emmargin-left5emline-heightnormalletter-spacingnormal3
padding-right13emmargin-right5em body3
0 0533
padding-right13emmargin-right5em susaawrichtextclickableskinrichtextcontainer3
oldirrtl padding-right13emmargin-right5em3
5px rgba03
2px 5px3
padding-right13emmargin-right5em heading3
ultxtnew ol3
sanssans-serif color0c3c60word-breakbreak-worddisplayinline-blockline-height13
style-j8osmsaknavcontainerarrow style-j8osmsaknavcontainersvgcontainer3
animation-duration 03s3
cursor pointer3
0s opacity0border-radius03
pafter contentpositionabsolutebottom-12pxright10pxcolorffftext-shadow03
contentpositionabsolutebottom-12pxright10pxcolorffftext-shadow0 1px3
box-sizingborder-box importantfontnormal3
importantfontnormal normal3
1 pggcg0gallerydisplayerhover3
justify-content center3
p transitionopacity3
box display3
box-sizingborder-box importantoverflowhiddencursorpointer3
importantoverflowhiddencursorpointer important3
box-sizingborder-box importantbackground-colorrgba2183
importantbackground-colorrgba218 2373
03s animation-timing-function3
100 width3
255 1box-sizingborder-box3
0 border1px3
0px 0positionrelativewhite-spacenowrap3
202 13
solid rgba513
rgba51 513
51 513
border-radius0 positionabsolutetop0right0bottom0left0transitionborder-color3
impactimpact-w01-2010impact-w02-2010impact-w10-2010sans-serif transitioncolor3
232 1border-colorrgba123
border-radius0 fontnormal3
1border-colorrgba12 603
border-radius0 positionabsolutetop0right0bottom0left0background-colorrgba1493
positionabsolutetop0right0bottom0left0background-colorrgba149 1983
96 1border-radius03
contentpositionabsolutetext-aligncenterbottom50left-20pxwidth20pxheight20pxline-height20px importantmargin-bottom-11pxcolorfffbackgroundf00border2px3
contentpositionabsolutebottom50left3pxmargin0 03
0 important3
n height3
0322
1154
2128
ease107
n104
0s98
normal93
important83
04s78
ul62
background-color58
1px56
rgba054
shqgiconleftimagebuttonwithtextbuttontextwrapper52
solid51
color47
0544
transition42
displaynone37
display36
-archetype36
0px36
336
435
528
628
lifirst-of-type28
008s28
margin0line-heightnormalletter-spacingnormal28
horizontalmenu2645433724menu27
open27
box-sizing26
cubic-bezier02526
3px25
all25
body25
fontnormal25
heading25
ol25
shqgiconleftimagebuttonwithtextbuttonextrainfo24
height24
color00000024
lrichtextcontainer24
shqgiconleftimagebuttonwithtextbuttonlabel24
srichtextcontainer24
positionabsolutetop0right0bottom0left024
sanssans-serif24
box-shadow023
li23
05s22
susaawrichtextclickableskinrichtextcontainer21
we21
div21
margin-left20
720
border-radius019
cursorpointer19
818
rgba1218
color0c3c6018
background-colorrgba25518
5px18
txtnew18
inherit17
center17
border-box17
border-width1px16
1border-radius016
980px16
positionstaticbox-shadow00016
916
shqgiconleftimagebuttonwithtextbuttonicon16
transitioncolor16
calc10016
border-color16
overflow16
1016
13px13em15
1115
1bordersolid15
width14
1214
position14
transform14
1314
content14
box-shadow14
cursor14
pointer-events14
you14
opacity14
style-j8osmsaknavcontainer13
horizontalmenusubitem3001285389overflowbox13
border13
width10013
rgba25513
none13
-controller-part-type12
1412
transparent12
us12
inset12
justify-content12
cubic-bezier012
1512
list-style-typesquareline-heightnormal12
flex12
1611
box-sizingborder-box11
0611
100n11
playsans-serif11
font11
opacity111
1711
03s11
item11
p11
have11
style-j8osmsaknavcontainerarrow11
your11
1border-stylesolidborder-colorrgba16310
background-colorrgba20410
our10
ffffff10
auto10
spanbefore10
2px9
overflowhidden9
span9
flexn9
text-aligninitialdisplayflexalign-itemscenter9
transitionopacity9
padding-right13emmargin-right5em9
justify-contentcenter9
justify-contentflex-start9
justify-contentflex-end9
horizontalmenuitem490841043overflowbox9
more9
style-j8osmsakrepeaterbuttonshade9
svg9
189
199
0pxcursorpointer9
tblc19
1box-sizingborder-box8
wati1input8
uldirrtl8
align-items8
b3labelwrapper8
b3label8
bible8
background-colorrgba1798
style-kgau1sxq1input8
section8
text-aligncenter8
max-width8
min-width8
layoutchilddisplaydropdown8
lilast-of-type8
208
4px8
0n8
inheritn8
transitionborder-color7
border1px7
urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutcur7
padding07
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomoutpng7
bordersolid7
text-alignleft7
background-colorrgba2187
urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoomincur7
cursorurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbasecursorzoominpng7
217
autooverflowhiddendisplayblock7
227
var7
if7
default7
unset7
16px13em7
colore4523f7
10px7
god7
info7
hidden7
some7
236
visibility6
christmas6
style-j8osmsaknavcontainerarrowstyle-j8osmsaknavcontainercenter-direction6
flex-grow6
experience6
b3link6
background-colorrgba1496
style-j8osmsaknavcontainerarrowstyle-j8osmsaknavcontainerright-direction6
oldirrtl6
black6
animation-name6
box6
animation-timing-function6
animation-duration6
avoid6
1ms6
linear6
not6
z-index6
any6
list-style-typecircleline-heightnormal6
keyframes6
0c3c606
boxn6
nonen6
margin6
flex-wrap6
my6
0pxdisplayinline-blockpositionrelative6
pagg1buttons6
style-j8osmsaknavcontainerarrowstyle-j8osmsaknavcontainerleft-direction6
tainputtextarea6
margin06
background-colorrgba126
select6
borderrgba1756
background-colorffffff6
opacity06
fffborder-radius50box-shadow06
margin-top6
nn5
5pxdisplayinline5
positionabsolutebottom10pxleft0right0text-aligncentercolor0c3c605
1transitionborder-color5
watai1data-stateinvalid5
pafter5
background-colorrgba1755
imagebutton1defaultimage5
thursday5
fathers5
imagebutton1activeimage5
pggcg0gallerydisplayerhover5
40px5
background-colorrgba275
centern5
border-boxnn5
house5
importantfont-size14pxcolor0c3c605
his5
imagebutton1hoverimage5
right05
left05
tbody5
right-20pxbackground-position1005
left-20pxbackground-position05
rgba2185
their5
pggcg4itemscontainer5
1border-stylesolidborder-colorrgba2555
moodus5
pggcg1itemscontainer5
05font-size12pxfont-weightbold5
-7px5
015s5
unsetn5
no-repeat5
ultxtnew5
scroll5
horizontalmenusubitem3001285389label5
text5
absolute5
urlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseshiny1buttonbgpng5
top5
horizontalmenuheadingitem4038900883label5
horizontalmenuitem490841043label5
left5
1background-colorrgba2555
new5
0000005
245
255
app1data-stateloading5
style-jqmqstx14
shqgiconleftimagebuttonwithtextdirection-ltrshqgiconleftimagebuttonwithtextsize-40shqgiconleftimagebuttonwithtextbutton4
style-jsanw9gk2labelwrapper4
shqgiconleftimagebuttonwithtextdirection-rtlshqgiconleftimagebuttonwithtextsize-32shqgiconleftimagebuttonwithtextbutton4
ahorizontalmenusubmenu1642244324listwrapper4
shqgiconleftimagebuttonwithtextdirection-ltrshqgiconleftimagebuttonwithtextsize-36shqgiconleftimagebuttonwithtextbutton4
shqgiconleftimagebuttonwithtextdirection-rtlshqgiconleftimagebuttonwithtextsize-36shqgiconleftimagebuttonwithtextbutton4
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl4
shqgiconleftimagebuttonwithtextdirection-rtlshqgiconleftimagebuttonwithtextsize-40shqgiconleftimagebuttonwithtextbutton4
padding-right4
snkvktouchmediazoomimageinfo4
ahorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-rtl4
bottom4
sutwetouchmediazoomiteminfo4
spanhorizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scrollhorizontalmenu2645433724---direction-3-ltr4
shqgiconleftimagebuttonwithtextdirection-ltrshqgiconleftimagebuttonwithtextsize-32shqgiconleftimagebuttonwithtextbutton4
-webkit-animation-nameshqgiconleftimagebuttonwithtextheartbeatanimation-nameshqgiconleftimagebuttonwithtextheartbeat-webkit-animation-duration05sanimation-duration05s4
1s4
pggcg3itemscontainer4
heightcalc1004
pggcg0gallerydisplayer4
selectdata-previewhover4
border-stylesolidborder-colorrgba2494
importantborder-radius04
white-spacenormal4
0154
border-width2px4
items4
padding-box4
td4
shqgiconleftimagebuttonwithtextdirection-ltrshqgiconleftimagebuttonwithtextsize-28shqgiconleftimagebuttonwithtextbutton4
shqgiconleftimagebuttonwithtextdirection-rtlshqgiconleftimagebuttonwithtextsize-28shqgiconleftimagebuttonwithtextbutton4
border-radiusinherit4
lrichtextcontainerbody4
word-break4
style-jsanw9gk2label4
style-jsanw9gk2link4
submenu4
spanhorizontalmenusubmenu1642244324listwrapper4
they4
scheduled4
back4
state4
connecticut4
day4
virus4
stay4
safety4
no4
group4
block4
absoluten4
39729b4
textn4
19px13em4
impactimpact-w01-2010impact-w02-2010impact-w10-2010sans-serif4
34px12em4
border-boxn4
mass4
based4
menu4
stylablebutton643855516icon4
style-kgau1sxylabelwrapper4
style-kgau1sxylink4
style-kgau1sxylabel4
importantoverflowhiddencursorpointer4
columns4
margin-right4
flex-shrink4
has4
loving4
into4
nbsp4
white-space4
02s4
padding4
study4
story4
transformation4
he4
selectdata-previewfocus4
srichtextcontainerheading4
h14
text-alignright4
topautobottom04
border-radius2px4
positionabsolutetop0right0bottom0left0background-colorrgba2184
024
importantmargin-bottom-11pxcolorfffbackgroundf00border2px4
h44
positionrelative4
rgba2494
wacb14
ecomrfc1link4
ecomrfc1labelwrapper4
ecomatc1label4
ecomatc1link4
ecomatc1labelwrapper4
text-alignjustify4
watai14
positionabsolutetop0right0bottom0left0transitionborder-color4
h54
h24
b3data-disabledfalseactivedata-statemobile4
b3data-disabledtrue4
ecomvc1labelwrapper4
ecomvc1link4
ecomvc1label4
ecomco1labelwrapper4
0positionrelativewhite-spacenowrap4
h64
list-style-typedecimal4
b3data-stateshoulduseflex4
list-style-typedisc4
font-styleinheritfont-weightinheritline-heightinheritletter-spacingnormal4
-2pxcolorffftext-shadow1px4
h34
b1labelwrapper4
app1inlinecontent4
importantz-index504
importantleftauto4
positionfixed4
b1label4
infinite4
lb1itemscontainer4
app1loading3
daedff3
1n3
0533
03sn3
b1link3
rgba513
overflowhiddenheight1003
importantbackground-colorrgba2553
positionabsolutetop0right0bottom0left0border-radius5px3
hiddenn3
-webkit-keyframes3
positionrelativewidth100height100word-wrapbreak-word3
auton3
repeat-xbordersolid3
padding-left13emmargin-left5emline-heightnormalletter-spacingnormal3
iframe3
road3
nowrapn3
pointer3
-webkit-transform3
carol3
nnn3
paginationnext-webkit-user-selectnonedisplayinline-block-ms-user-selectnone-webkit-touch-calloutnonepadding03
positionabsolutetop0right0bottom0left0box-sizingborder-box3
0593
blocknn3
do3
263
been3
every3
taken3
margin-top03
1border-radius5px3
border0px3
0pxpositionrelativewhite-spacenowrap3
also3
positionabsolutebottom-26pxwidth165pxheight26pxbackgroundurlhttpsstaticparastoragecomservicesskins2122980imageswysiwygcorethemesbaseliftedshadowmediumpng3
273
spirit3
horizontalmenusubitem3001285389expandrighttranslate3
nninfosvgtypeshapeviewbox03
visible3
no-repeatpointer-eventsnone3
readers3
paintbox3
6px3
paintboxnn3
horizontalmenuitem490841043expandsubmenu3
horizontalmenuitem490841043container3
colordaedff3
horizontalmenusubitem3001285389expandlefttranslate3
0923
pagg1opc3
nowrap3
importantbackground-colorrgba2183
stylablehorizontalmenu4089050981columnslayout3
textareafocus3
shqgiconleftimagebuttonwithtextsize-28shqgiconleftimagebuttonwithtextbutton3
displayblock3
dotted3
style-j8osmsakrepeaterbuttonlabel3
1transitionbackground-color3
color0c3c60word-breakbreak-worddisplayinline-blockline-height13
border03
pggcg2itemscontainer3
text-alignrightdirectionrtl3
style-j8osmsaknavcontainercenter-direction3
style-j8osmsaknavcontainerright-direction3
opacity0border-radius03
rgba2273
backgroundtransparent3
contentpositionabsolutebottom-12pxright10pxcolorffftext-shadow03
selectdata-previewerror3
style-j8osmsaknavcontainersvgcontainer3
style-j8osmsaknavcontainerleft-direction3
selecthover3
importantfontnormal3
ecomti1data-stateinvalid3
selectfocus3
selectdata-errortrue3
pagg1autoplay3
ecometi1input3
ecometi1erase3
shqgiconleftimagebuttonwithtexttype-like-clickedshqgiconleftimagebuttonwithtextsize-28shqgiconleftimagebuttonwithtextbutton3
stylablehorizontalmenu4089050981menuitem3
everyone3
wix-image3
personal3
jesus3
each3
life3
pagg1rolloverholder3
horizontalmenusubmenu1642244324heading3
1border-colorrgba123
horizontalmenusubmenu1642244324menuitem3
ecomco1link3
box-shadownone3
positionabsolutetop0right0bottom0left0background-colorrgba1493
imagebutton1data-statepressed3
imagebutton1data-statehovered3
right3
shqgiconleftimagebuttonwithtextsize-32shqgiconleftimagebuttonwithtextbutton3
horizontalmenu2645433724roothorizontalmenu2645433724---menumode-6-scroll3
sutwetouchmediazoomitemimagecontainer3
displayblockoverflowhidden3
snkvktouchmediazoomimageimagecontainer3
snkvktouchmediazoomcentereddiv3
shqgiconleftimagebuttonwithtexttype-like-clickedshqgiconleftimagebuttonwithtextsize-40shqgiconleftimagebuttonwithtextbutton3
rgba573
shqgiconleftimagebuttonwithtextsize-40shqgiconleftimagebuttonwithtextbutton3
shqgiconleftimagebuttonwithtexttype-like-clickedshqgiconleftimagebuttonwithtextsize-36shqgiconleftimagebuttonwithtextbutton3
contentpositionabsolutetext-aligncenterbottom50left-20pxwidth20pxheight20pxline-height20px3
shqgiconleftimagebuttonwithtextsize-36shqgiconleftimagebuttonwithtextbutton3
shqgiconleftimagebuttonwithtexttype-like-clickedshqgiconleftimagebuttonwithtextsize-32shqgiconleftimagebuttonwithtextbutton3
sc3bg3
contentpositionabsolutebottom50left3pxmargin03
importantheight1003

Who hosts Myfathershousect.org?

Myfathershousect.org Hosting Provider Information

Hosted IP Address:23.236.62.147
Hosted Hostname:147.62.236.23.bc.googleusercontent.com
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:Pepyaka/1.19.0

Is "Google Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for Myfathershousect.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Thu, 26 Nov 2020 14:51:29 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
x-wix-request-id: 1606402289.86874951900015316
link:; rel=preconnect; crossorigin,; rel=preconnect; crossorigin,; rel=preconnect;,; rel=preload; as=script;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preload; as=script ; crossorigin=anonymous;,; rel=preconnect; crossorigin;,; rel=preload; as=script ; crossorigin=anonymous
content-language: en
Age: 0
Server-Timing: cache;desc=miss, varnish;desc=miss, dc;desc=euw2
Expires: Thu, 01 Jan 1970 00:00:00 GMT
Vary: Accept-Encoding
X-Seen-By: sHU62EDOGnH2FBkJkG/Wx8EeXWsWdHrhlvbxtlynkVhQj1BaGUHEZdeNXf9X2Qzk,2d58ifebGbosy5xc FRaloPX4ngKfQM8fEHbwELHijnxvRAnncD52eyefYlJT/8QWIHlCalF7YnfvOr2cMPpyw==,Nlv1KFVtIvAfa3AK9dRsI4MZ1kUUgUkrs5Mf5K7Ze4MfbJaKSXYQ/lskq2jK6SGP,2UNV7KOq4oGjA5 PKsX47BxIqOBp/BcxgT00NVTD1Qk=,qquldgcFrj2n046g4RNSVPD6c5erGeYLdtSDjMSpcyU=,m7d0zj9X6FBqkyAIyh66vKIvwATwZVFq79A7HEqeyFlNG KuK VIZfbNzHJu0vJu,kO0u 7q TL0DeeE//9W7MCB lJWJe4 PpVc3vmAQsR/CWwNxKSOQYr0Nw8DFLg27WIHlCalF7YnfvOr2cMPpyw==,m7d0zj9X6FBqkyAIyh66vKIvwATwZVFq79A7HEqeyFlNG KuK VIZfbNzHJu0vJu,Tw2AanFDQ Wwo8Xxk6ZL7vOBx hvh2Cbd7MMNUXzbHHb0cbWitsDc7FQE79rs5CZdNWuaPR7LN2kKFOpzm9YDOYzODd/TWayCnbpn1KADvM=,u3CNwl6zAd2E01MQck4H7Gf/eTXynzZHisSRFyqHDfSTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,l7Ey5khejq81S7sxGe5Nk1LKZe618YROIUHXvjy1Z3FNG KuK VIZfbNzHJu0vJu,LlHHrtdZwfqSTe7u8ayFI0G3ybJlEMQoDW11NrJgY4QPKGn HJoRaxEK0kY8nAhQEmh3Ctd0jO8qfEEIgPd0ag==,u3CNwl6zAd2E01MQck4H7Gf/eTXynzZHisSRFyqHDfSTzRA6xkSHdTdM1EufzDIPWIHlCalF7YnfvOr2cMPpyw==,vnnyTBxZ51OQwVc1vV5ZXOM9kwxMkaDJU98dWpOHS1NNG KuK VIZfbNzHJu0vJu,CU5GbgCT5nWPaA3tUS4mLGIKXacaXu6vTDycYV TU eyWA23VeEnpcPgX8CiNGXlpbgvLbGWnbg5QV4Q5Ztvzw==
cache-control: private,max-age=0,must-revalidate
Server: Pepyaka/1.19.0
Content-Encoding: gzip

Myfathershousect.org Domain Nameserver Information

HostIP AddressCountry
ns6.wixdns.net 216.239.32.100
ns7.wixdns.net 216.239.34.100


Need to find out who hosts Myfathershousect.org?


Domain Registration (WhoIs) information for Myfathershousect.org

 Domain Name: MYFATHERSHOUSECT.ORG
Registry Domain ID: D187382675-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2020-03-16T14:25:22Z
Creation Date: 2016-04-08T21:48:54Z
Registry Expiry Date: 2021-04-08T21:48:54Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8003337680
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization:
Registrant State/Province: FL
Registrant Country: US
Name Server: NS6.WIXDNS.NET
Name Server: NS7.WIXDNS.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2020-11-26T14:50:31Z

Websites with Similar Names

Myfatbabeadventures.com
My Fat Babe Adventures
Myfatbombfor.com
Under Construction | Doteasy
Myfatboyspizza.com
Fat Boy's Pizza | Johnston, RI 02919 | Order Pizza Online | Pizza Menu | Pizza Delivery
Myfatburn.com
myfatburn.com
Myfatburner.net
myfatburner.net -&nbspmyfatburner Resources and Information.
Myfatburneroff.com
The Miracle Fat Burner!

Recently Updated Websites

Lestudiocreateur.com (2 seconds ago.)Lovekindlyboutique.com (2 seconds ago.)Ketomargaritas.com (2 seconds ago.)Liveinstylist.com (2 seconds ago.)Liveyourpurposebook.com (2 seconds ago.)Marrowtech.com (3 seconds ago.)Lemaskboutique.com (3 seconds ago.)Lvlolvla.com (3 seconds ago.)Localinvestingforum.com (4 seconds ago.)Kyoeitsushin.com (4 seconds ago.)Gymiza.com (4 seconds ago.)Litneyland.com (4 seconds ago.)Hochatownchapel.com (4 seconds ago.)Leadershipmomentuminstitute.com (5 seconds ago.)Learnenglishwithjeff.com (5 seconds ago.)Malwarebwtes.com (6 seconds ago.)Lesnudettes.com (6 seconds ago.)Kirispa.com (6 seconds ago.)Gymprimary.com (6 seconds ago.)Llc-gruenden.com (7 seconds ago.)Lostriver-construction.com (7 seconds ago.)Londoncraftgirl.com (7 seconds ago.)Lindseycrank.com (7 seconds ago.)Maestriaenmeditacion.com (7 seconds ago.)Livedevotionals.com (7 seconds ago.)Mangocomputer.com (7 seconds ago.)Leptonai.com (8 seconds ago.)Kambiumclosets.com (8 seconds ago.)Lsrichstudio.com (8 seconds ago.)Lubetzkyphotography.com (8 seconds ago.)

Recently Searched Keywords

foto ãfrica - fotografia e vã­deo (2 seconds ago.)boyut ve dier-ailelere (4 seconds ago.)pingentes (4 seconds ago.)albums sur (4 seconds ago.)viking feast on the beach (5 seconds ago.)fresh produce vegetable fruit storage containers 3packs (5 seconds ago.)event is organised (6 seconds ago.)ipsum quia dolor (6 seconds ago.)urban destinations (7 seconds ago.)freestyle faq joomla 3 (8 seconds ago.)корпоративные туры (9 seconds ago.)oyeshub (11 seconds ago.)yemen news (12 seconds ago.)eleanorlowe (12 seconds ago.)nissan uae (12 seconds ago.)6:09 شقراء الدهون مع الحمار ضخمة انتشرت ساقيها مفتوحة على مصراعيها وحصلت بوسها حفر جيدة (12 seconds ago.)哪些人可以制作纯银纪念章? (12 seconds ago.)7152019 1133 (15 seconds ago.)ðžñ„ð¸ñð½ð°ñ ð¼ðµð±ðµð»ñŒ (17 seconds ago.)ads posted today (17 seconds ago.)республика алтай (19 seconds ago.)rus (20 seconds ago.)wcfmmp-store bannerimg (20 seconds ago.)our history (23 seconds ago.)148 (23 seconds ago.)caps and mittens (23 seconds ago.)entrepreneurssurvive (24 seconds ago.)door repair (24 seconds ago.)haare (25 seconds ago.)каталог косметики (25 seconds ago.)