Home | Montgomery Community Media

Safety: Low trust score
Year Founded: 2010
Global Traffic Rank: 195,135
Estimated Worth: $64,200



Domain summary

Last updated
2021-07-23
Domain label
mymcmedia
Domain extension
org
Domain registered:
2010-08-24
Domain updated:
2021-07-23
Global Traffic Rank
195,135
Statvoo Rating
F
Trust Score
Low Trust Score
Estimated worth
$64,200
Estimated daily income
$107
Estimated monthly income
$3,255

Frequently Asked Questions (FAQ)

Q: When was Mymcmedia.org registered?
A: Mymcmedia.org was registered 10 years, 11 months, 1 week, 2 days, 22 hours, 25 minutes, 56 seconds ago on Tuesday, August 24, 2010.
Q: When was the WHOIS for Mymcmedia.org last updated?
A: The WHOIS entry was last updated 1 week, 3 days, 22 hours, 25 minutes, 56 seconds ago on Friday, July 23, 2021.
Q: What are Mymcmedia.org's nameservers?
A: DNS for Mymcmedia.org is provided by the following nameservers:
  • ns73.worldnic.com
  • ns74.worldnic.com
Q: Who is the registrar for the Mymcmedia.org domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for Mymcmedia.org?
A: Mymcmedia.org ranks 195,135 globally on Alexa. Mymcmedia.org has a Low Trust Score, and a Statvoo Rank of F.
Q: How many people visit Mymcmedia.org each day?
A: Mymcmedia.org receives approximately 8,568 visitors and 42,840 page impressions per day.
Q: What IP address does Mymcmedia.org resolve to?
A: Mymcmedia.org resolves to the IPv4 address .
Q: In what country are Mymcmedia.org servers located in?
A: Mymcmedia.org has servers located in the .
Q: What webserver software does Mymcmedia.org use?
A: Mymcmedia.org is powered by Pagely-ARES/1.9.3 webserver.
Q: Who hosts Mymcmedia.org?
A: Mymcmedia.org is hosted by Unknown in .
Q: How much is Mymcmedia.org worth?
A: Mymcmedia.org has an estimated worth of $64,200. An average daily income of approximately $107, which is roughly $3,255 per month.

Mymcmedia.org Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Mymcmedia.org Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Mymcmedia.org

H1 Headings

1 :
  1. Montgomery Community Media

H2 Headings

41 :
  1. 5 Things to Know Today, July 23, in Montgomery County
  2. Pandemic Inspires Local Small Business Owner to Open New Restaurant
  3. County Piloting ‘SolarAPP+’ Platform to Instantly Approve Solar Permits for Residents 
  4. Stone Ridge Makes Splash for Olympians Ledecky, Bacon
  5. FCC, FTC Warn of Auto Warranty Scams
  6. Takoma Park Imprints Local Poems in New Sidewalks
  7. 5 Things to Know Today, July 23, in Montgomery County
  8. Pandemic Inspires Local Small Business Owner to Open New Restaurant
  9. County Piloting ‘SolarAPP+’ Platform to Instantly Approve Solar Permits for Residents 
  10. Stone Ridge Makes Splash for Olympians Ledecky, Bacon
  11. FCC, FTC Warn of Auto Warranty Scams
  12. Takoma Park Imprints Local Poems in New Sidewalks
  13. 5 Things to Know Today, July 23, in Montgomery County
  14. Stone Ridge Makes Splash for Olympians Ledecky, Bacon
  15. Food Waste Management Changing in Maryland
  16. Trial Date Set for Takoma Park Murders
  17. Hombre de Hyattsville Fallece en Accidente en Silver Spring
  18. Blog: Things are Shakin’ in Germantown
  19. Blog: Prince Philip – Cool Dude
  20. Blog: Small Business: Understanding Payroll Expenses
  21. Blog: SEP IRA vs SIMPLE IRA (For Self Employed)
  22. Blog: The Afterlife of Prince Philip, Duke of Edinburgh
  23. Pandemic Inspires Local Small Business Owner to Open New Restaurant
  24. Takoma Park Imprints Local Poems in New Sidewalks
  25. Templo Mormón de Washington D.C. Abrirá al Público el Próximo Año
  26. Programa ‘Feed the Fridge’ en Clínica Mary’s Center de Silver Spring Busca Erradicar el Hambre
  27. KID Museum on the Move
  28. County Piloting ‘SolarAPP+’ Platform to Instantly Approve Solar Permits for Residents 
  29. FCC, FTC Warn of Auto Warranty Scams
  30. County Looks to Support Minors Coming from the Border
  31. Fox 5 D.C. Anchor Moves Her Desk
  32. Elrich Proposes First of its Kind Energy-Reducing Bill
  33. Pandemic Inspires Local Small Business Owner to Open New Restaurant
  34. County Piloting ‘SolarAPP+’ Platform to Instantly Approve Solar Permits for Residents 
  35. Stone Ridge Makes Splash for Olympians Ledecky, Bacon
  36. Templo Mormón de Washington D.C. Abrirá al Público el Próximo Año
  37. With Recent Spike in COVID-19 Cases County Leaders Stress Importance of Vaccine
  38. Wounded Army Vet to Move to Specialized Home in Poolesville
  39. Sign Up For Our Newsletter
  40. Sign Up For Our Daily Update
  41. About MyMCMedia

H3 Headings

8 :
  1. News
  2. Our Bloggers
  3. Community
  4. Government
  5. Videos
  6. Video Posts
  7. Engage us on Facebook
  8. Follow us on Twitter

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

47 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-24746278-1

Links - Internal

122:

Links - Internal (nofollow)

0:

Links - Outbound

25:

Links - Outbound (nofollow)

0:

Keyword Cloud for Mymcmedia.org

news tipsolar permitsmontgomery countymakescovid19government julyowner to openinstantlyblogsmall businesslinethings to knowolympianssidewalkstrainingnewsledeckyopen newplatform to instantlymontgomery communityviewapprove solar permitsresidentsjuly 21today july 23local smalldcinstantly approveapproveridge makes splashyouthmontgomery community mediajulyjuly 22 2021home21 2021view allup2021 blogsolarappautoclassesjuly 21 2021small5 thingsinspires local smallmore1warnparkpublic safetypiloting solarapp platformsplashsolarwarn of autobusinesscommunity mediaridge makesgovernment july 22ftc2publictiphave22 2021usplatformnewdonateinspirestelevisionmymcmediagovernmentlifeopentodaymakes splashknow today julypoemsauto warrantyimprintssmall business ownerhealthsafetyridgeinspires localapprove solarpiloting solarappaccessservicesmediawarrantybacontip lineelknowpilotingalltakoma parksplash for olympianspermitsftc warninstantly approve solarlocal small business0new sidewalksnews tip linemcmartscommunity23 in montgomeryvolunteervideosknow todaytoday julyimprints local poemsourcountysportsthingspodcastcontactolympians ledeckypark imprints4pandemicjuly 23takomasolarapp platformreadpoems in newstonemedia mcmbusiness ownerjuly 22community julyowner3localmontgomerypark imprints localimprints localcommunity july 22blogslocal poems

Longtail Keyword Density for Mymcmedia.org

KeywordsOccurences
july 22 202114
things to know5
government july 224
platform to instantly4
july 21 20214
splash for olympians4
ridge makes splash4
approve solar permits4
montgomery community media4
instantly approve solar4
piloting solarapp platform4
owner to open4
small business owner4
local small business4
inspires local small4
23 in montgomery3
warn of auto3
park imprints local3
imprints local poems3
poems in new3
today july 233
community july 223
know today july3
news tip line3
july 2214
22 202114
government july5
july 235
view all5
local small5
small business5
instantly approve4
21 20214
july 214
community july4
2021 blog4
olympians ledecky4
makes splash4
ridge makes4
solar permits4
approve solar4
solarapp platform4
montgomery community4
open new4
business owner4
inspires local4
community media4
public safety4
piloting solarapp4
today july3
media mcm3
5 things3
know today3
local poems3
new sidewalks3
takoma park3
imprints local3
park imprints3
auto warranty3
ftc warn3
montgomery county3
tip line3
news tip3
july27
023
114
montgomery13
local12
mcm11
community10
new8
business8
county8
government8
blog7
things7
public7
media7
all6
26
read6
small6
our6
residents6
us6
news6
solar5
ledecky5
training5
park5
know5
35
poems5
ridge5
view5
open5
piloting4
solarapp4
sports4
platform4
instantly4
approve4
permits4
makes4
splash4
olympians4
owner4
auto4
inspires4
ftc4
safety4
blogs4
44
today4
health4
home4
dc3
stone3
el3
volunteer3
sidewalks3
takoma3
services3
warranty3
imprints3
classes3
warn3
podcast3
donate3
tip3
line3
mymcmedia3
arts3
life3
more3
up3
bacon3
youth3
videos3
television3
covid-193
contact3
have3
pandemic3
access3

Who hosts Mymcmedia.org?

Mymcmedia.org Hosting Provider Information

Hosted IP Address:Not Applicable
Hosted Hostname:Not Applicable
Service Provider:Unknown
Hosted Country:Not Applicable
Location Latitude:Not Applicable
Location Longitude:Not Applicable
Webserver Software:Pagely-ARES/1.9.3

Is "Unknown" in the Top 10 Hosting Companies?

Name
Percentage
GOOGLE
16.3509%
Unknown
7.9282%
AS-26496-GO-DADDY-COM-LLC
4.2120%
NAMECHEAP-NET
3.4686%
AMAZON-AES
2.5797%
GoDaddy.com, LLC
2.3421%
UNIFIEDLAYER-AS-1
2.2322%
Fara Negar Pardaz Khuzestan
1.8901%
CONFLUENCE-NETWORK-INC
1.6374%
1&1 Internet AG
1.5839%

HTTP Header Analysis for Mymcmedia.org

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Fri, 23 Jul 2021 13:33:08 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 22524
Connection: keep-alive
Vary: Accept-Encoding
Server: Pagely-ARES/1.9.3
X-Gateway-Request-Id: 7c63a617579250a761a9bf19d127a83f
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Link:; rel="https://api.w.org/", ; rel="alternate"; type="application/json", ; rel=shortlink
Content-Encoding: gzip
X-Gateway-Cache-Key: 1627037271.975|standard|https|www.mymcmedia.org||/
X-Gateway-Cache-Status: MISS
X-Gateway-Skip-Cache: 0

Mymcmedia.org Domain Nameserver Information

HostIP AddressCountry
ns73.worldnic.com 162.159.26.27
ns74.worldnic.com 162.159.27.78


Need to find out who hosts Mymcmedia.org?


Domain Registration (WhoIs) information for Mymcmedia.org

 Domain Name: MYMCMEDIA.ORG
Registry Domain ID: D159977239-LROR
Registrar WHOIS Server: whois.networksolutions.com
Registrar URL: http://www.networksolutions.com
Updated Date: 2020-05-06T14:45:08Z
Creation Date: 2010-08-24T19:49:25Z
Registry Expiry Date: 2022-08-24T19:49:25Z
Registrar Registration Expiration Date:
Registrar: Network Solutions, LLC
Registrar IANA ID: 2
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8777228662
Reseller:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registrant Organization:
Registrant State/Province: FL
Registrant Country: US
Name Server: NS73.WORLDNIC.COM
Name Server: NS74.WORLDNIC.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/)
>>> Last update of WHOIS database: 2021-07-23T13:32:08Z

Websites with Similar Names

Mymcmann.com
Index of /
Mymcmedia.org
Home | Montgomery Community Media
Mymcminsurance.com
mymcminsurance – Just another WordPress site
Mymcmlife.com
myMCMlife.com | musings on a life inspired by art, faith and family

Recently Updated Websites

Kohlscouponsdaily.com (10 seconds ago.)Inmagarcianb.com (12 seconds ago.)Warriorsfreedomapparel.com (17 seconds ago.)Effectscbd.com (18 seconds ago.)Workandsolution.info (22 seconds ago.)Alcidesamorim.com (22 seconds ago.)Outearnyourself.com (24 seconds ago.)Assistenzacomputers.it (27 seconds ago.)Hafele-shop.com.vn (33 seconds ago.)Ejv-wrs.work (34 seconds ago.)Pesetron.net (34 seconds ago.)Creamfieldschina.com (34 seconds ago.)Qlm777.com (35 seconds ago.)Unlimitedlink.com (37 seconds ago.)Bbfarmadvw32cb.space (38 seconds ago.)Strengthpsychology.com (39 seconds ago.)Embassyservices.in (40 seconds ago.)103.studio (40 seconds ago.)Taximadridclass.com (43 seconds ago.)Shortboy.net (45 seconds ago.)Hiredcustomerservice.com (47 seconds ago.)2061.su (49 seconds ago.)Cobanatesihareketi.kim (53 seconds ago.)Displayhdr.org (54 seconds ago.)Datatilsynet.no (57 seconds ago.)Tracyjones.realtor (59 seconds ago.)Maidensrealm.com (1 minute 3 seconds ago.)Kolos.org (1 minute 8 seconds ago.)Tool-kompass.com (1 minute 9 seconds ago.)Anmaisi6.com (1 minute 10 seconds ago.)

Recently Searched Keywords

ароматерапия и эфирные масла для похудения. (1 second ago.)人事信息 (1 second ago.)tööpakkumised (2 seconds ago.)2012-01-31 nemcare hospital wins prestigious  (3 seconds ago.)票务 (3 seconds ago.)tekstil sektrnn (7 seconds ago.)tiene unnbspcosto (8 seconds ago.)society home (8 seconds ago.)производÑ�тво химичеÑ�ких вещеÑ�тв и химичеÑ�ких продуктов (9 seconds ago.)fucking her (10 seconds ago.)публикация доклада в электронном сборнике всероссийской конференции.редакционный сбор 230 руб. (11 seconds ago.)dawson (12 seconds ago.)the atelier (13 seconds ago.)haestrk (13 seconds ago.)station electric vehicle (14 seconds ago.)third avenue hove (14 seconds ago.)- кроссовки (14 seconds ago.)supreme mad emperor system chapter 52 (15 seconds ago.)bad lesbian girls (15 seconds ago.)programme ducatif les (16 seconds ago.)centre du programme (17 seconds ago.)toolsshore (18 seconds ago.)lakiery (18 seconds ago.)чачома чи марто, вечкевикс любовь борисовна! (18 seconds ago.)au centre du (18 seconds ago.)les formations dispenses (19 seconds ago.)tarantula (19 seconds ago.)sterne (20 seconds ago.)localhost-academy (20 seconds ago.)dfw brick repair dallas, fort worth, granbury (21 seconds ago.)