Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-11-14
Category: News and Media


Domain summary

Domain label
najrannews
Domain extension
com.sa
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is najrannews.com.sa ranked relative to other sites:

Percentage of visits to najrannews.com.sa from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Najrannews.com.sa registered?
A: Najrannews.com.sa was registered 3 months, 2 weeks, 3 days, 9 hours, 50 minutes, 13 seconds ago on Saturday, November 14, 2020.
Q: When was the WHOIS for Najrannews.com.sa last updated?
A: The WHOIS entry was last updated 3 months, 2 weeks, 3 days, 9 hours, 50 minutes, 13 seconds ago on Saturday, November 14, 2020.
Q: What are Najrannews.com.sa's nameservers?
A: DNS for Najrannews.com.sa is provided by the following nameservers:
  • ns3.dimofinf.net
  • ns1.dimofinf.net
  • ns2.dimofinf.net
Q: Who is the registrar for the Najrannews.com.sa domain?
A: The domain has been registered at .
Q: What is the traffic rank for Najrannews.com.sa?
A: Najrannews.com.sa has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Najrannews.com.sa each day?
A: Najrannews.com.sa receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Najrannews.com.sa resolve to?
A: Najrannews.com.sa resolves to the IPv4 address 85.17.16.70.
Q: In what country are Najrannews.com.sa servers located in?
A: Najrannews.com.sa has servers located in the Netherlands.
Q: What webserver software does Najrannews.com.sa use?
A: Najrannews.com.sa is powered by Nginx webserver.
Q: Who hosts Najrannews.com.sa?
A: Najrannews.com.sa is hosted by LeaseWeb Netherlands B.V. in Netherlands.
Q: How much is Najrannews.com.sa worth?
A: Najrannews.com.sa has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Najrannews.com.sa Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Najrannews.com.sa Free SEO Report

Website Inpage Analysis for Najrannews.com.sa

H1 Headings

1 :
  1. لقد قمنا بإطلاق موقعنا الجديد

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

1 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

4:

Links - Outbound (nofollow)

0:

Who hosts Najrannews.com.sa?

Najrannews.com.sa Hosting Provider Information

Hosted IP Address:85.17.16.70
Hosted Hostname:unlimited2.dimofinf.net
Service Provider:LeaseWeb Netherlands B.V.
Hosted Country:NetherlandsNL
Location Latitude:52.3824
Location Longitude:4.8995
Webserver Software:nginx

Is "LeaseWeb Netherlands B.V." in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
LeaseWeb Netherlands B.V.
0.1658%

HTTP Header Analysis for Najrannews.com.sa

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Sat, 14 Nov 2020 20:57:15 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Retry-After: 86400
Cache-Control: max-age=172800
Expires: Mon, 16 Nov 2020 20:57:13 GMT
X-XSS-Protection: 1; mode=block
X-Nginx-Cache-Status: MISS
X-Server-Powered-By: Dimofinf INC
Content-Encoding: gzip

Najrannews.com.sa Domain Nameserver Information

HostIP AddressCountry
ns3.dimofinf.net 95.179.144.169
ns1.dimofinf.net 45.55.127.247
ns2.dimofinf.net 167.99.30.33


Need to find out who hosts Najrannews.com.sa?


Domain Registration (WhoIs) information for Najrannews.com.sa

 % SaudiNIC Whois server.
% Rights restricted by copyright.
% http://nic.sa/en/view/whois-cmd-copyright

Domain Name: najrannews.com.sa

Registrant:
صحيفة نجران نيوز الالكترونية
Address: السعودية - حائل
حائل
المملكة العربية السعودية

Administrative Contact:
مانع صالح ****** ************
Address: ***************
****
************************

Technical Contact:
محمد عبدالله ************
Address: ************************************************
******
************************

Name Servers:
ns2.dimofinf.net
ns1.dimofinf.net
ns3.dimofinf.net

DNSSEC: no

Websites with Similar Names

Najran.cc
الصفحة الرئيسية | قبائل نجران
Najran.digital
najran.digital is available for purchase - Sedo.com
Najran.online
najran.online - Registered at Namecheap.com
Najranagifts.com
NajranaGifts.com - Site Underconstruction

Recently Updated Websites

Point2point.biz (9 seconds ago.)Minhzy.com (10 seconds ago.)Ionship.com (10 seconds ago.)Leighrhodesphotos.org (12 seconds ago.)Livvyfloral.com (12 seconds ago.)Mbacreditbuilder.com (12 seconds ago.)Jogacoin.com (14 seconds ago.)Myhuaxiang.com (14 seconds ago.)Braendhub.com (15 seconds ago.)Coinseattle.com (16 seconds ago.)Expert-opinions.com (18 seconds ago.)Guvenlesat.com (20 seconds ago.)Automc2.info (20 seconds ago.)Homesbylexie.com (20 seconds ago.)Morgancreekforsale.com (24 seconds ago.)Academicdogtraining.info (26 seconds ago.)Justsaybubbles.com (27 seconds ago.)Daleypour.com (29 seconds ago.)Site-unseen.com (29 seconds ago.)Goingonforgod.org (30 seconds ago.)Casseymcallon.com (30 seconds ago.)Americansurvivalpros.com (31 seconds ago.)Youslyfox.com (32 seconds ago.)Sophiaovadia.com (33 seconds ago.)Yunews.ru (35 seconds ago.)Webpanoramia.com (35 seconds ago.)Winchendonhomevalues.com (38 seconds ago.)Ocovertimeattorney.com (47 seconds ago.)Wujiaojiao.com (49 seconds ago.)Frozentoaster.com (49 seconds ago.)

Recently Searched Keywords

bass ukir (1 second ago.)viewing reading (2 seconds ago.)tokens left (3 seconds ago.)jai vigneshwara builders poonamallee chennai (5 seconds ago.)1 do (16 seconds ago.)realizujemy caĺ‚y wachlarz usĺ‚ug tartacznych (19 seconds ago.)covid helpline numbers (29 seconds ago.)1 -1 (1 minute ago.)rcps.loyale.us.central maine (1 minute 2 seconds ago.)preferences backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11promotitle (1 minute 5 seconds ago.)fiery_redhead (1 minute 6 seconds ago.)7x7 wigunited (1 minute 14 seconds ago.)0try (1 minute 23 seconds ago.)consultancy bedrijven (1 minute 39 seconds ago.)0s 1 (1 minute 50 seconds ago.)vn c th (1 minute 52 seconds ago.)vn anh (1 minute 55 seconds ago.)fat-teen-porn (1 minute 56 seconds ago.)vit nam tin (1 minute 57 seconds ago.)vit nam t (1 minute 59 seconds ago.)introducing the ion torrent genexus system learn more › (2 minutes 3 seconds ago.)amazonプライム会員とは? (2 minutes 3 seconds ago.)0928 (2 minutes 17 seconds ago.)vit nam mua (2 minutes 26 seconds ago.)vin giao hng (2 minutes 28 seconds ago.)vin giao (2 minutes 30 seconds ago.)ls17 update (2 minutes 34 seconds ago.)356hk (2 minutes 35 seconds ago.)vi mc gi (2 minutes 40 seconds ago.)big cash download (2 minutes 41 seconds ago.)