Nalekcje.pl

Website Thumbnail
Checking...
Nalekcje.pl - nalekcje.pl

Safety: Low trust score
Year Founded: 2019
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-11-07
Category: This site has not been categorized yet


Domain summary

Domain label
nalekcje
Domain extension
pl
Domain registered:
2019-08-22
Domain updated:
2020-08-09
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is nalekcje.pl ranked relative to other sites:

Percentage of visits to nalekcje.pl from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Nalekcje.pl registered?
A: Nalekcje.pl was registered 1 year, 3 months, 1 week, 16 hours, 49 minutes, 54 seconds ago on Thursday, August 22, 2019.
Q: When was the WHOIS for Nalekcje.pl last updated?
A: The WHOIS entry was last updated 3 months, 2 weeks, 6 days, 16 hours, 49 minutes, 54 seconds ago on Sunday, August 9, 2020.
Q: What are Nalekcje.pl's nameservers?
A: DNS for Nalekcje.pl is provided by the following nameservers:
  • ns2.webio.pl
  • ns1.webio.pl
Q: Who is the registrar for the Nalekcje.pl domain?
A: The domain has been registered at NASK.
Q: What is the traffic rank for Nalekcje.pl?
A: Nalekcje.pl has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Nalekcje.pl each day?
A: Nalekcje.pl receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Nalekcje.pl resolve to?
A: Nalekcje.pl resolves to the IPv4 address 178.32.149.185.
Q: In what country are Nalekcje.pl servers located in?
A: Nalekcje.pl has servers located in the Poland.
Q: What webserver software does Nalekcje.pl use?
A: Nalekcje.pl is powered by Apache webserver.
Q: Who hosts Nalekcje.pl?
A: Nalekcje.pl is hosted by OVH SAS in Poland.
Q: How much is Nalekcje.pl worth?
A: Nalekcje.pl has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Nalekcje.pl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Nalekcje.pl Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Nalekcje.pl

H1 Headings

0 :

H2 Headings

4 :
  1. Relacje z wydarzeń edukacyjnych
  2. Testy i recenzje
  3. Materiały edukacyjne do pracy zdalnej i w klasie
  4. Inspiracje

H3 Headings

2 :
  1. W Nalekcje.pl stawiamy na rozwój Wasz i Waszych uczniów!
  2. Webinaria / Szkolenia online

H4 Headings

4 :
  1. SZKOLIMY
  2. TWORZYMY MATERIAŁY NA LEKCJE
  3. Polecamy
  4. dla nauczycieli i rodziców

H5 Headings

3 :
  1. SKLEP
  2. PRAWNE
  3. Kontakt

H6 Headings

2 :
  1. Made in Media Andrzeja Struga 78/A101 90-557 Łódź
  2. [email protected]

Total IFRAMEs

0 :

Total Images

30 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-148739378-1

Links - Internal

25:
  1. https://nalekcje.pl/
    https://nalekcje.pl/
  2. Nalekcje Home
    http://nalekcje.pl
  3. Nalekcje Aktualności
    https://nalekcje.pl/category/aktualnosci/
  4. Nalekcje Raporty Edukacyjne
    https://nalekcje.pl/raporty-edukacyjne/
  5. Nalekcje Ankieta
    https://nalekcje.pl/glowna/ankieta_dla_nauczycieli/
  6. Nalekcje Zapisy na webinar
    https://nalekcje.pl/webinar/
  7. Nalekcje Materiały edukacyjne
    https://materialy.nalekcje.pl
  8. Nalekcje 0
    https://nalekcje.pl/koszyk/
  9. Nalekcje Sprawdź
    https://nalekcje.pl/produkt/science-lab-fascynujaca-anatomia-czlowieka/
  10. Nalekcje Przejdź do platformy
    https://materialy.nalekcje.pl
  11. Nalekcje Zobacz webinary Zobacz webinary
    https://nalekcje.pl/webinar/
  12. Nalekcje Pobierz Materialy.NaLekcje.pl Pobierz Materialy.NaLekcje.pl
    https://materialy.nalekcje.pl/
  13. Nalekcje Sprawdź Sprawdź
    https://nalekcje.pl/zapowiedz-recenzji-gry-karcianej-akcja-na-parkiecie-do-edukacji-finansowej-wyd-fundacja-gpw/
  14. Nalekcje materialy.nalekcje.pl
    https://materialy.nalekcje.pl
  15. Nalekcje Zapisz się na webinar Zapisz się na webinar
    https://nalekcje.pl/webinar
  16. Nalekcje Więcej aktualności Więcej aktualności
    https://nalekcje.pl/category/aktualnosci/
  17. Nalekcje Więcej testów i recenzji
    https://nalekcje.pl/category/recenzja/
  18. Nalekcje Przechodzę do platformy z materiałami
    https://materialy.nalekcje.pl
  19. Nalekcje Sklep
    https://nalekcje.pl/sklep/
  20. Nalekcje Multimedia edukacyjne
    https://nalekcje.pl/category/multimedia-edukacyjne/
  21. Nalekcje Gry edukacyjne
    https://nalekcje.pl/category/gry/
  22. Nalekcje Strona główna
    https://nalekcje.pl/recenzje/
  23. Nalekcje Regulamin serwisu
    https://nalekcje.pl/regulamin-serwisu/
  24. Nalekcje Polityka prywatności
    https://nalekcje.pl/polityka-cookies/
  25. Nalekcje dowiedz się więcej.
    https://nalekcje.pl/polityka-cookies/

Links - Internal (nofollow)

0:

Links - Outbound

5:
  1. http://pxlz.edge-themes.com/
    http://pxlz.edge-themes.com/
  2. https://www.facebook.com/nalekcje
    https://www.facebook.com/nalekcje
  3. https://www.youtube.com/channel/UCYNn6HVQVUfqpC2JGt9_KQQ
    https://www.youtube.com/channel/UCYNn6HVQVUfqpC2JGt9_KQQ
  4. https://youtu.be/y_vF_UZhgVg
    https://youtu.be/y_vF_UZhgVg
  5. https://youtu.be/DpFGJD3bXnA
    https://youtu.be/DpFGJD3bXnA

Links - Outbound (nofollow)

0:

Keyword Cloud for Nalekcje.pl

szkvarprodukty dzikiprogramowejnalekcjeplhtmldivcssdocumentcreateelementdiv htmldivinnerhtmlrozwijaniu kompetencji kluczowychsprawdeorazedukacyjnych doifdziki ktrymrozwijaniuvar htmldiv documentcreateelementdivowiatowychdlaz uczniamiwicejna0htmldiv documentcreateelementdiv htmldivinnerhtmle warto rekomendowaslidertworzcwiedzelse var htmldivcsiktrewypenianiehtmldivinnerhtml htmldivinnerhtmlpracy z uczniamiuczniamiwebinariarozwijaniu kompetencjiendkompetencjiincludepomocekompetencji kluczowychhtmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0abywarto rekomendowa produktyzserwisukadegohtmldivinnerhtml htmldivcss elseprzedszkolikluczowychifhtmldivhtmldivinnerhtml htmldivinnerhtml htmldivcsserrormessageprzedszkoli i szknauczycielipomagadocumentcreateelementdivpodstawyzapisytakehtmldivpobierzelse vardo pracyvar htmldivcssmateriaywspierapomaga wfunctionnieolubuczniwmogpomaga w rozwijaniuhtmldivcss elsedowarto rekomendowamateriawpracy zpasjedocumentcreateelementdiv htmldivinnerhtml htmldivcsse wartoifhtmldiv htmldivinnerhtmlwebinarpodstawy programowejprodukty dziki ktrymhtmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes0var htmldiv documentgetelementbyidrspluginsettingsinlinecssifhtmldiv htmldivinnerhtml htmldivinnerhtmlswoichzainteresowaniasi narekomendowa produktyhtmldivinnerhtml htmldivcssw rozwijaniu kompetencjitrecipasje i zainteresowaniaw rozwijaniuhtmldivcss else varvar htmldivktrymrekomendowaelsemateriay edukacyjnerevolutiondzikidocumentgetelementbyidrspluginsettingsinlinecssproduktyhtmldivinnerhtmlstrzau0142ekwrekomendowa produkty dzikihtmldiv documentcreateelementdivdocumentgetelementsbytagnamehead0appendchildhtmldivchildnodes0aktualnocihtmldiv documentgetelementbyidrspluginsettingsinlinecsswebinarydoskonaleniana webinarpracyedukacyjnychedukacyjnewartodo pracy zmaterialynalekcjepl

Longtail Keyword Density for Nalekcje.pl

KeywordsOccurences
htmldivinnerhtml htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes04
var htmldiv documentgetelementbyidrs-plugin-settings-inline-css4
documentcreateelementdiv htmldivinnerhtml htmldivcss4
htmldiv documentcreateelementdiv htmldivinnerhtml4
var htmldiv documentcreateelementdiv4
else var htmldiv4
htmldivcss else var4
htmldivinnerhtml htmldivcss else4
htmldivinnerhtml htmldivinnerhtml htmldivcss4
ifhtmldiv htmldivinnerhtml htmldivinnerhtml4
rozwijaniu kompetencji kluczowych4
w rozwijaniu kompetencji4
do pracy z3
pomaga w rozwijaniu3
pasje i zainteresowania3
produkty dziki ktrym3
rekomendowa produkty dziki3
warto rekomendowa produkty3
e warto rekomendowa3
pracy z uczniami3
przedszkoli i szk3
var htmldiv8
htmldivinnerhtml htmldivcss8
pracy z4
htmldivcss documentgetelementsbytagnamehead0appendchildhtmldivchildnodes04
documentcreateelementdiv htmldivinnerhtml4
htmldiv documentcreateelementdiv4
else var4
htmldivcss else4
htmldiv documentgetelementbyidrs-plugin-settings-inline-css4
htmldivinnerhtml htmldivinnerhtml4
ifhtmldiv htmldivinnerhtml4
w rozwijaniu4
rozwijaniu kompetencji4
kompetencji kluczowych4
do pracy4
var htmldivcss4
na webinar4
edukacyjnych do3
materiay edukacyjne3
pomaga w3
podstawy programowej3
dziki ktrym3
produkty dziki3
rekomendowa produkty3
warto rekomendowa3
e warto3
z uczniami3
si na3
w23
z21
do20
var18
na16
si15
htmldivcss12
htmldivinnerhtml12
edukacyjne11
take9
o9
materiay8
htmldiv8
nalekcjepl7
pracy7
else6
kompetencji6
function6
errormessage6
oraz6
aby5
uczniw5
produkty5
edukacyjnych5
05
swoich5
e4
documentgetelementsbytagnamehead0appendchildhtmldivchildnodes04
documentgetelementbyidrs-plugin-settings-inline-css4
lub4
szk4
ktre4
webinar4
aktualnoci4
documentcreateelementdiv4
kluczowych4
rozwijaniu4
if4
c4
nauczycieli4
ktrym4
nie4
ifhtmldiv4
dla4
wicej3
include3
slider3
end3
webinary3
revolution3
pobierz3
materialynalekcjepl3
tworzc3
programowej3
sprawd3
rekomendowa3
przedszkoli3
doskonalenia3
kadego3
wiedz3
materiaw3
uczniami3
treci3
mog3
warto3
dziki3
zapisy3
pasje3
zainteresowania3
pomoce3
webinaria3
wspiera3
wypenianie3
owiatowych3
podstawy3
pomaga3
serwisu3
strzau0142ek3

Who hosts Nalekcje.pl?

Nalekcje.pl Hosting Provider Information

Hosted IP Address:178.32.149.185
Hosted Hostname:cluster020.hosting.ovh.net
Service Provider:OVH SAS
Hosted Country:PolandPL
Location Latitude:52.2394
Location Longitude:21.0362
Webserver Software:Apache

Is "OVH SAS" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%

HTTP Header Analysis for Nalekcje.pl

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 07 Nov 2020 13:57:01 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Server: Apache
X-Powered-By: PHP/7.2
Link:; rel=shortlink
Vary: X-Forwarded-Proto,Accept-Encoding
Content-Encoding: gzip
Referrer-Policy: no-referrer-when-downgrade

Nalekcje.pl Domain Nameserver Information

HostIP AddressCountry
ns2.webio.pl 79.187.155.101
ns1.webio.pl 194.88.154.133


Need to find out who hosts Nalekcje.pl?


Domain Registration (WhoIs) information for Nalekcje.pl

 DOMAIN NAME: nalekcje.pl
registrant type: organization
nameservers: ns1.webio.pl. [194.88.154.133]
ns2.webio.pl. [79.187.155.100]
created: 2019.08.22 13:23:18
last modified: 2020.08.09 21:45:53
renewal date: 2021.08.22 13:23:18

no option

dnssec: Unsigned

REGISTRAR:
MSERWIS Sp.z o.o. sp. k.
ul. Stacyjna 1/63
53-613 Login to show email
database responses: https://dns.pl/en/whois

WHOIS displays data with a delay not exceeding 15 minutes in relation to the .pl Registry system

Websites with Similar Names

Nalekberov.com
TOLERANT - Login
Nalekcje.pl
Nalekcje.pl - nalekcje.pl
Naleki.com
Nalekia
Naleksis.com
502 Server Error

Recently Updated Websites

Utvgoat.club 3 seconds ago.Thegreenspring.us 3 seconds ago.Uyelp.com 5 seconds ago.Certainstandardproductions.com 5 seconds ago.Mycinehub.com 6 seconds ago.Ilfan.id 9 seconds ago.3355tk.com 10 seconds ago.Azarakhshsanat.com 11 seconds ago.Deeprootfilm.com 15 seconds ago.Bowlontario5pin.ca 15 seconds ago.Lighting-servicesinc.com 17 seconds ago.Dofinance.club 20 seconds ago.Yiyizhixiao.com 23 seconds ago.Darrowan.com 23 seconds ago.71sl.com 23 seconds ago.Sexinthewoods.com 25 seconds ago.Safetyfist.com 26 seconds ago.Yujunhong.cn 29 seconds ago.Letifer.eu 29 seconds ago.Aym-events.com 29 seconds ago.Itsuer.com 31 seconds ago.Bob.sh 33 seconds ago.Johnsebben.com 33 seconds ago.Queenofpawns.net 33 seconds ago.Dugunsamdan.com.tr 34 seconds ago.Lamontbuyshouses.com 38 seconds ago.Denuncio.com 38 seconds ago.Handeebks.com 39 seconds ago.Jebalatlas.com 41 seconds ago.Lisatorracolaw.com 43 seconds ago.