Helsekost - Køb helsekost billigt i Københavns hyggeligste helsekostbutik

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-12-03
Category: This site has not been categorized yet

Stort udvalg af helsekost til lave priser! Hos Natur Poteket forhandler vi bl.a. superfoods, kosttilskud, hudpleje og glutenfri produkter. FRI FRAGT over 399,-


Domain summary

Domain label
naturpoteket
Domain extension
dk
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is naturpoteket.dk ranked relative to other sites:

Percentage of visits to naturpoteket.dk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Naturpoteket.dk registered?
A: Naturpoteket.dk was registered 1 month, 3 weeks, 2 days, 3 hours, 24 minutes, 52 seconds ago on Thursday, December 3, 2020.
Q: When was the WHOIS for Naturpoteket.dk last updated?
A: The WHOIS entry was last updated 1 month, 3 weeks, 2 days, 3 hours, 24 minutes, 52 seconds ago on Thursday, December 3, 2020.
Q: What are Naturpoteket.dk's nameservers?
A: DNS for Naturpoteket.dk is provided by the following nameservers:
  • ns2.curanet.dk
  • ns1.curanet.dk
Q: Who is the registrar for the Naturpoteket.dk domain?
A: The domain has been registered at .
Q: What is the traffic rank for Naturpoteket.dk?
A: Naturpoteket.dk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Naturpoteket.dk each day?
A: Naturpoteket.dk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Naturpoteket.dk resolve to?
A: Naturpoteket.dk resolves to the IPv4 address 35.214.245.73.
Q: In what country are Naturpoteket.dk servers located in?
A: Naturpoteket.dk has servers located in the United States.
Q: What webserver software does Naturpoteket.dk use?
A: Naturpoteket.dk is powered by Nginx webserver.
Q: Who hosts Naturpoteket.dk?
A: Naturpoteket.dk is hosted by Merit Network Inc. in California, Mountain View, United States, 94043.
Q: How much is Naturpoteket.dk worth?
A: Naturpoteket.dk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Naturpoteket.dk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Naturpoteket.dk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Naturpoteket.dk

H1 Headings

0 :

H2 Headings

8 :
  1. Altid gode tilbud
  2. Tilbudsvarer
  3. Din informationskilde til naturens mirakler
  4. Stort udvalg af Kosttilskud
  5. Kosttilskud
  6. Du finder os her.
  7. Kun hos Naturpoteket
  8. Bedst sælgende

H3 Headings

30 :
  1. Pollen Bio, rå tørret 250 g.
  2. Pollen, Propolis & Royal Jelly i Honning
  3. OrganiCup model B
  4. Probiotic Classic 10 - 100 gram - NDS
  5. Solaray B Mega b stress 250 kap.
  6. Omega m. citrussmag - 473 mL - Nordic Naturals
  7. Probiotic Classic 10 - 200 gram - NDS
  8. Probiotic I.L.D. 10 - NDS
  9. Tørgær, Glutenfri
  10. Arya Laya Aloe Vera skum Douche
  11. Pantotensyre 120 mg, Natur Drogeriet
  12. eye q chews - EPA+DHA+GLA - fiskeolie - 180 tyggekapsler m. jordbærsmag
  13. eye q - EPA+DHA+GLA - fiskeolie - 180 kapsler
  14. eye q - EPA+DHA+GLA - fiskeolie - økonomistørrelse 360 kapsler
  15. Astragalus Elderberry & Garlic Complex - astragalus hyldebær & hvidløg kompleks - Terra...
  16. Living multinutrient - multivitamin med urter - Terra Nova
  17. Digestive Enzyme Complex - fordøjelsesenzymer - Terra Nova
  18. Easy Iron Complex 20 mg - Jernkompleks - Terra Nova
  19. Ingefær 400 mg - Natur Drogeriet
  20. Original Silicea Mave-Tarm Gel 200 ml.
  21. 2 Stk Gikisa Kirsebærsaft 3 l. bag in box fra Ellegården på Stevns
  22. Hvedekim Øko - 200 g
  23. Henna Maja Super Renforce, Tidligere Henna Maia, 200 g.
  24. 4 stk Gikisa Kirsebærsaft 3 l. bag in box fra Ellegården på Stevns
  25. Surkål, sauerkraut, uopvarmet, raw , 410 g
  26. Monki Tahin med salt, Økologisk 330 g.
  27. 5 STK Gikisa Kirsebærsaft fra Ellegården på Stevns
  28. Akupressur ringe til selvbehandling
  29. Mælkesyrede Grøntsager uopvarmet, raw Grøntsagsmix 410 g
  30. 15 STK Gikisa Kirsebærsaft GRATIS FRAGT! nu med pantmærker

H4 Headings

10 :
  1. Rense Te 100 g fra Natur Poteket
  2. Kvinde te
  3. Snøf te fra Natur Poteket
  4. Stress te
  5. Slap af te, Naur Poteket
  6. Amme te, ny forbedret.
  7. Marlbouro man te
  8. Baby olie Natur Poteket
  9. Kulsukker tinktur 30 ml.
  10. Ren Mandelolie 275 ml

H5 Headings

6 :
  1. Hudpleje & Skønhed
  2. Flotte lotus stager
  3. Mad & drikke
  4. Sign up to newsletter
  5. Kundeservice
  6. Contact us

H6 Headings

1 :
  1. Besøg os på Christianshavn

Total IFRAMEs

1 :

Total Images

53 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-73006049-1

Links - Internal

172:

Links - Outbound (nofollow)

0:

Keyword Cloud for Naturpoteket.dk

gikisastkgamma linolensyre frapx pxelementorelementelementorelement4ibsv61solaray0emborderradiuspx px pxer fremstillet affra fiskeoliepx px pxelementorelementelementorelementgkyxon0stresspxpadding2em6pxlinolensyre fra kmpenatlysoliepx pxelementorelementelementorelementgkyxon0pxelementorelementelementorelement3aop8rc0pxpaddingpxellegrdenpxelementorelementelementorelementtsre92z elementorwidgetcontainermarginpxpx px pxpadding2emanbefalet dagligpx pxelementorelementelementorelementnlqavbrkurvanbefalede dagligekosttilskud denertil genskabelse ogpx pxmarginpx pxolierpxfiskeoliebakteriestammerdagligter certificeret0emborderradiuspxkirsebrsaft fra surekmpenatlysolielog15 minmngde 200dagligt opls 1mlkesyrebakteriererudvalgetflerumttede2000krpxelementorelementelementorelement6wunw45 elementorwidgetcontainermarginpx pxelementoriqitbannerpxpadding2em 2em 2emoksegelatine der eraf et sundtsauerkraut2em 2empxelementorelementelementorelementz78b3sx elementorwidgetcontainermarginpxsundt fordjelsessystem anbefaletanbefaletfordjelsen tarmflorabakterierfra ellegrdenfedtsyrerkapselskallen er fremstilletdha omega3 fedtsyrerpx pxelementorelementelementorelementorl94abfordjelsessystemkosttilskud eye qfremstillet af oksegelatine5 stkudvalgte bakteriestammer tilmedvirkest 15med etfedtsyrer medpulverform tildosisflerumttede fedtsyrer medsomterra nova terrakombination aftil dha omega30em 1em 0emborderradiuspxindhold afbr ikkeelementorbuttonelementorbackgroundoverlayborderradiuspx px20pxpollentepx pxelementorelementelementorelement3aop8rcog kosher obligatoriskden anbefalede dagligeog tilsat gla15 min frfordjelsendha bidrager tilgenskabelsepxelementorelementelementorelementmg2oo0dpxelementorelementelementorelementz78b3sxpxelementorelementelementorelementgkyxon0 elementoriqitbannertarmflorabakteriersaltfra ellegrden per certificeret halal12000krharelementorelementpopulatedmarginpx px pxpxelementorelementelementorelementjdss2iu0empx px pxmarginpxteskebrugpx px pxelementorelementelementorelementnfapcvnelementorelementpopulatedmarginpxmedelementorbuttonmargintoppxelementorelementelementorelementgkyxon0 elementorwidgetcontainermarginpx pxpx px pxelementorelementelementorelementzq14hdpamp drikkepxelementorelementelementorelement7asouq8pxpadding1em2til genskabelseikke trdedaglige dosispx px pxelementorelementelementorelementk9dsvpbelementorelementpopulatedborderradiuspx pxyourgla gammabakteriestammer til fordjelsenvarkurv mad amp10hudplejemin fr indtagelsepx px pxelementorelementelementorelement85fuan6forholdnymed et naturligtkurv madtsk i vandpx pxelementorelementelementorelementt4awjqzpxmarginpxpxelementorelementelementorelementt4awjqzpxpadding0pxgla gamma linolensyrenatur poteketbr ikke overskridespx px pxelementorelementelementorelementwu6j571grampxelementorelementelementorelement4ibsv61sure kirsebroksegelatine dertil bedrepx pxelementorelementelementorelementwu6j571fedtsyrer med etpxelementorelementelementorelementz78b3sx elementorwidgetcontainermarginpx pxfiskeolie og tilsatpx px pxelementorelementelementorelement6wunw45dosis 1 teskeprodukter ogepabagtarmflorabakterier i pulverform2embarnpx pxelementorelementelementorelement8qb1e9mp tilbudelementorwidgetcontainermarginpx px pxdha bidrager0em 1emmad amp drikkekologiskpx pxpaddingpx pxindholdvand og ladmgog kosmetikpx pxpxelementorelementelementorelementorl94abfra sure kirsebrkosttilskud brpx px pxelementorelementelementorelementjdss2iunaturpx px pxelementorelementelementorelement3aop8rcmedvirke tilforhold til dhamlkesyrede grntsagermagnifoodhalal oget sundtpx pxelementorelementelementorelementgkyxon0 elementoriqitbannerkirsebrfr indtagelse mngdepxelementorelementelementorelementblqyv3oelementorbuttonmargintoppxelementorelementelementorelementgkyxon0pxborderradiuspx pxdaglig dosis 1hjere afbalanceret indhold10 udvalgte bakteriestammeraf oksegelatine derviomega6g lgpxelementorelementelementorelementjf9wr9phelseprodukter7mngdesundtudvalgtepx pxborderradiuspxpx pxpadding0px 0pxtrdepxborderradiuspxflerumttede fedtsyrerpx px pxelementorelementelementorelementcaljlfgnds nds1boxanbefaledekapsler1 teskekosttilskud br ikkefra kmpenatlysolie omega6pxelementorelementelementorelementyuroj6xastragalusnaturligt hjere afbalanceretanbefalede daglige dosisoverskrides kosttilskud brpx px pxelementorelementelementorelement8nbti7nlad st 152 stkindeholderpx pxelementorelementelementorelementyuroj6xsrlig kombinationpxpadding2em 2emopls 1fedtsyrer fra fiskeolienaturalsmadpx px pxelementorelementelementorelement7asouq8pxelementorelementelementorelementlizdmp0se udvalget0emborderradiuspx pxpx pxelementorelementelementorelementq8e2qnopxelementorelementelementorelementgkyxon0medvirke til bedrepx pxelementorelementelementorelement85fuan6elementoriqitbannercontentpaddingpx px1pxder ertilsatp tilbud 2000krpxelementorelementelementorelementtsre92z elementorwidgetcontainermarginpx pxpx pxelementorelementelementorelement6wunw45 elementorwidgetcontainermarginpxpx pxpadding2empx px pxelementorelementelementorelementjgeqbd3tilsat gla gammaikke overskridespxelementorelementelementorelement6wunw45flaskertrretelementoriqitbannercontentpaddingpx px pxkosttilskudprodukterkurv p tilbudteske dagligtvitaminertil fordjelsen tarmflorabakterierpx px pxelementorelementelementorelementorl94abbestillerkmpenatlysolie omega6px pxelementorelementelementorelementzq14hdppxpaddingpxdrogerietfedtsyrerkapselskallenst 15 minbrpx pxelementorelementelementorelementz78b3sxpx pxelementorelementelementorelementz78b3sx elementorwidgetcontainermarginpxobligatorisk tekstsehennader er certificeretliterpx px pxelementorelementelementorelement4ibsv61essentiellestk gikisapxelementorelementelementorelement8nbti7nlg i kurvopls 1 tskpx pxpadding1empx pxelementorelementelementorelementlizdmp0fra terranovapxelementorelementelementorelementrqh8x8gprobioticnova terrafrden anbefaledeteske dagligt oplsfremstillet afnordic naturalsqfedtsyrer frabidrager tilkosher obligatorisk0pxborderradiuspx px pxindtagelsepulverform til genskabelsedaglighalal og kosheromega3 fedtsyrerstk gikisa kirsebrsaftdagligt oplstil dhahjere afbalanceretpxelementorelementelementorelement8qb1e9mpulverformpx pxelementorelementelementorelementjgeqbd3pxelementorelementelementorelementnlqavbrndspxmarginpx pxamp mineraler410 gtekst for kosttilskudleftfordjelsessystem anbefalet0pxborderradiuspxkosterpx pxelementorelementelementorelementtsre92z elementorwidgetcontainermarginpx0remoksegelatinekosher obligatorisk tekstafbalanceret indholdnatur drogerietpxpadding1em 0emkosttilskud eyeforhold tilhjere9tilsat glapx pxelementorelementelementorelementrqh8x8gelementoriqitbanner elementoriqitbannertitlemarginpxelementorelementpopulatedborderradiuspx px pxtilbud 2000krdosis 1obligatoriskpxelementorelementelementorelementrqh8x8g elementorwidgetcontainermarginpx px4900kromega3udvalgte bakteriestammertil bedre svnpx pxelementorelementelementorelementnfapcvnpx px pxelementorelementelementorelementyuroj6xsuperindtagelse mngdeindgenskabelse ogpx pxelementorelementelementorelementjdss2iukombination af essentielleampet naturligtog medvirke tilladgamma linolensyrepxelementorelementelementorelement6wunw45 elementorwidgetcontainermarginpxeye q0pxpaddingpx pxpx pxborderradiuspx pxvedligeholdelseog medvirkeomega6 fedtsyrerkapselskallen erbhvedekimmin frog vedligeholdelse afpx pxelementorelementelementorelementk9dsvpbhonningpx pxmarginpxsure kirsebr franovaindhold af epaterranovaterra novapxelementorelementelementorelementtsre92zbedre svnnaturligtog tilsatp stevnswebshopmed 56px 0pxborderradiuspx pxdosis br ikkepx pxpaddingpxtil fordjelsenkirsebr fra ellegrdenmllinolensyre frakirsebr fra4surevoresepadhagla fiskeoliepx pxelementorelementelementorelementjf9wr9pminfr indtagelsecomplexnova terra novapx pxelementorelementelementorelement8nbti7nfedtsyrerkapselskallen erbedrelayapx pxpadding2em 2emelementoriqitbannercontentpaddingpxpx px pxelementorelementelementorelementblqyv3odha omega34 stkcertificeret halal1emdenaf epafedtsyrer200 mlelementorwidgetcontainermarginpx pxafpxelementorelementelementorelementsptdllumangelog indpxpaddingpx px pxdagligeepa i forholdpx pxelementorelementelementorelementrqh8x8g elementorwidgetcontainermarginpxpoteket 4900krgenskabelse og vedligeholdelsemlkesyredeelementorbackgroundoverlayborderradiuspxgkombinationelementorbuttonmargintoppxelementorelementelementorelementgkyxon0 elementorwidgetcontainermarginpxnaturligt hjerekankosherelementorelementpopulatedborderradiuspxog vedligeholdelsepxelementorelementelementorelementcaljlfgpx pxelementorelementelementorelementtsre92zgikisa kirsebrsaftmorepadhaglawishlistpxelementorelementelementorelementnfapcvntekst0pxfra kmpenatlysoliepxpadding0px 0px 6px6px 0pxborderradiuspxpx pxelementorelementelementorelementblqyv3okmpenatlysolie omega6 fedtsyrerkapselskallenmineralerpx px pxelementorelementelementorelementjf9wr9pvandog kosherpx px pxelementorelementelementorelementq8e2qnopx pxpadding0pxet sundt fordjelsessystemaf oksegelatinecertificeret halal og200 gelementorbackgroundoverlayborderradiuspx px pxbidragerpx pxelementorelementelementorelementsptdlludrikkepx px pxborderradiuspxsrlig kombination aflinolensyrepx px pxelementorelementelementorelementtsre92zetbag in boxingredienserpxelementorelementelementorelementq8e2qnost1px 1pxessentielle flerumttedebakteriestammer tilomega3 fedtsyrer fraer fremstillet6kologisketilog lad1 tskomega6 fedtsyrerkapselskallenpx px pxelementorelementelementorelementnlqavbroverskridesom0pxpaddingpx px pxkirsebrsaft frafiskeolie ogdaglig dosiskurv kosttilskudvand ogelementoriqitbannertitlemarginpx8pxpaddingpx pxkirsebrsaft3vedligeholdelse aftskpx px pxpadding0pxpxelementorelementelementorelementjgeqbd3ikke overskrides kosttilskudellegrden pkosttilskud den anbefalede1em 0emborderradiuspxpxelementorelementelementorelementrqh8x8g elementorwidgetcontainermarginpxelementorwidgetcontainermarginpx0px 0pxlad stpx px pxelementorelementelementorelementt4awjqzoverskrides kosttilskudfordjelsessystem anbefalet dagliglgbr ikke trdepxmarginpx px px1 teske dagligtdenneaf essentielle flerumttedeellegrden p stevns5stevnskohlosseumpx px pxelementorelementelementorelementmg2oo0dterrapxborderradiuspx px pxpx pxelementorelementelementorelementmg2oo0dpx px pxpadding1emog lad stpx px pxelementorelementelementorelementsptdlluvidenskabeligeeyeglarawpxelementorelementelementorelement85fuan6gammastortpxelementorelementelementorelementk9dsvpbafbalanceret0pxborderradiuspx pxpx pxelementorelementelementorelement6wunw45dhapx px pxelementorelementelementorelement8qb1e9mmlkesyrebakterierer probioticpx px pxpaddingpxpx pxpadding1em 0empx px pxelementorelementelementorelementlizdmp0ikke0px 6pxnordickosmetikafbalanceret indhold afhalalpxpadding1em 0em 1emfraellerfragtessentielle flerumttede fedtsyrerdertilbud10 udvalgtesundt fordjelsessystem0px 6px 0pxborderradiuspxhoset naturligt hjereppx px pxelementorelementelementorelementrqh8x8g0omegadaglige dosis brfra fiskeolie ogpx pxelementorelementelementorelementcaljlfgoggrntsagerdindosis brkurv poplssvnsrligpoteketkunfra sureduenergipx pxelementorelementelementorelement7asouq8pxpadding0px 0pxpxelementorelementelementorelementzq14hdppx px pxelementorelementelementorelementz78b3sxvedligeholdelse af et0px 20px1em 0emborderradiuspx pxpxelementorelementelementorelementwu6j571af essentielleelementorelementpopulatedmarginpx pxmad ampfremstilletcertificeretaf etanbefalet daglig dosis

Longtail Keyword Density for Naturpoteket.dk

KeywordsOccurences
px pxpaddingpx px89
pxpaddingpx px px89
px px pxpaddingpx89
elementor-widget-containermarginpx px px73
lg i kurv30
elementor-element-populatedmarginpx px px22
pxborder-radiuspx px px16
px pxborder-radiuspx px16
px px pxborder-radiuspx16
kurv p tilbud14
mad amp drikke13
px px pxmarginpx8
elementor-iqit-banner-contentpaddingpx px px8
pxmarginpx px px8
px pxmarginpx px8
kurv mad amp7
fra ellegrden p7
elementor-background-overlayborder-radiuspx px px7
elementor-element-populatedborder-radiuspx px px7
px px pxpadding2em6
ellegrden p stevns6
px px pxpadding0px6
px px pxelementor-elementelementor-element-jdss2iu5
px px pxelementor-elementelementor-element-t4awjqz5
px pxpadding2em 2em5
pxpadding2em 2em 2em5
px px pxelementor-elementelementor-element-7asouq85
px pxpadding0px 0px5
0px 6px 0pxborder-radiuspx4
pxpadding0px 0px 6px4
kirsebr fra ellegrden4
6px 0pxborder-radiuspx px4
px px pxelementor-elementelementor-element-jf9wr9p4
px px pxelementor-elementelementor-element-blqyv3o4
0pxborder-radiuspx px px4
0emborder-radiuspx px px4
bag in box4
px px pxelementor-elementelementor-element-gkyxon04
sure kirsebr fra4
fra sure kirsebr4
kirsebrsaft fra sure4
stk gikisa kirsebrsaft4
px px pxpadding1em4
pxpadding1em 0em 1em4
1em 0emborder-radiuspx px4
0em 1em 0emborder-radiuspx4
px pxpadding1em 0em4
naturligt hjere afbalanceret3
fra fiskeolie og3
af essentielle flerumttede3
fra kmpenatlysolie omega-63
fedtsyrer med et3
med et naturligt3
linolensyre fra kmpenatlysolie3
gamma linolensyre fra3
gla gamma linolensyre3
tilsat gla gamma3
og tilsat gla3
fiskeolie og tilsat3
et naturligt hjere3
hjere afbalanceret indhold3
fedtsyrer fra fiskeolie3
flerumttede fedtsyrer med3
omega-3 fedtsyrer fra3
dha omega-3 fedtsyrer3
til dha omega-33
kmpenatlysolie omega-6 fedtsyrerkapselskallen3
essentielle flerumttede fedtsyrer3
epa i forhold3
indhold af epa3
afbalanceret indhold af3
forhold til dha3
dosis br ikke3
omega-6 fedtsyrerkapselskallen er3
anbefalede daglige dosis3
medvirke til bedre3
og medvirke til3
nova terra nova3
terra nova terra3
br ikke trde3
kosttilskud br ikke3
overskrides kosttilskud br3
ikke overskrides kosttilskud3
br ikke overskrides3
srlig kombination af3
daglige dosis br3
den anbefalede daglige3
fedtsyrerkapselskallen er fremstillet3
kosttilskud den anbefalede3
tekst for kosttilskud3
kosher obligatorisk tekst3
og kosher obligatorisk3
halal og kosher3
certificeret halal og3
er certificeret halal3
der er certificeret3
oksegelatine der er3
af oksegelatine der3
fremstillet af oksegelatine3
er fremstillet af3
kombination af essentielle3
et sundt fordjelsessystem3
kosttilskud eye q3
px px pxelementor-elementelementor-element-4ibsv613
px px pxelementor-elementelementor-element-8qb1e9m3
px px pxelementor-elementelementor-element-zq14hdp3
px px pxelementor-elementelementor-element-jgeqbd33
px px pxelementor-elementelementor-element-k9dsvpb3
px px pxelementor-elementelementor-element-orl94ab3
pxelementor-elementelementor-element-6wunw45 elementor-widget-containermarginpx px3
px pxelementor-elementelementor-element-6wunw45 elementor-widget-containermarginpx3
px px pxelementor-elementelementor-element-6wunw453
px px pxelementor-elementelementor-element-yuroj6x3
px px pxelementor-elementelementor-element-wu6j5713
pxelementor-elementelementor-element-z78b3sx elementor-widget-containermarginpx px3
px pxelementor-elementelementor-element-z78b3sx elementor-widget-containermarginpx3
px px pxelementor-elementelementor-element-z78b3sx3
pxelementor-elementelementor-element-tsre92z elementor-widget-containermarginpx px3
px px pxelementor-elementelementor-element-caljlfg3
px pxelementor-elementelementor-element-tsre92z elementor-widget-containermarginpx3
px px pxelementor-elementelementor-element-tsre92z3
px px pxelementor-elementelementor-element-nlqavbr3
px px pxelementor-elementelementor-element-8nbti7n3
px px pxelementor-elementelementor-element-mg2oo0d3
pxelementor-elementelementor-element-rqh8x8g elementor-widget-containermarginpx px3
px pxelementor-elementelementor-element-rqh8x8g elementor-widget-containermarginpx3
px px pxelementor-elementelementor-element-rqh8x8g3
px px pxelementor-elementelementor-element-q8e2qno3
0pxpaddingpx px px3
px px pxelementor-elementelementor-element-lizdmp03
elementor-buttonmargin-toppxelementor-elementelementor-element-gkyxon0 elementor-widget-containermarginpx px3
px pxelementor-elementelementor-element-gkyxon0 elementor-iqit-banner3
px px pxelementor-elementelementor-element-85fuan63
px px pxelementor-elementelementor-element-nfapcvn3
px px pxelementor-elementelementor-element-3aop8rc3
dha bidrager til3
daglig dosis 13
fr indtagelse mngde3
min fr indtagelse3
15 min fr3
st 15 min3
lad st 153
og lad st3
vand og lad3
tsk i vand3
opls 1 tsk3
dagligt opls 13
teske dagligt opls3
1 teske dagligt3
dosis 1 teske3
anbefalet daglig dosis3
px px pxelementor-elementelementor-element-sptdllu3
fordjelsessystem anbefalet daglig3
sundt fordjelsessystem anbefalet3
af et sundt3
vedligeholdelse af et3
og vedligeholdelse af3
genskabelse og vedligeholdelse3
til genskabelse og3
pulverform til genskabelse3
tarmflorabakterier i pulverform3
til fordjelsen tarmflorabakterier3
bakteriestammer til fordjelsen3
udvalgte bakteriestammer til3
10 udvalgte bakteriestammer3
p tilbud -2000kr3
til bedre svn3
px px271
pxpaddingpx px89
px pxpaddingpx89
elementor-widget-containermarginpx px73
elementor-element-populatedmarginpx px22
px pxborder-radiuspx16
pxborder-radiuspx px16
p tilbud15
mad amp14
kurv p14
1px 1px13
amp drikke13
eye q9
elementor-iqit-banner elementor-iqit-banner-titlemarginpx9
px pxmarginpx8
pxmarginpx px8
elementor-iqit-banner-contentpaddingpx px8
ellegrden p7
kurv mad7
terra nova7
fra ellegrden7
natur poteket7
elementor-element-populatedborder-radiuspx px7
elementor-background-overlayborder-radiuspx px7
p stevns6
px pxpadding0px6
g lg6
br ikke6
obligatorisk tekst6
px pxpadding2em6
kirsebrsaft fra5
pxpadding0px 0px5
0em 1em5
px pxelementor-elementelementor-element-7asouq85
2em 2em5
pxpadding2em 2em5
px pxelementor-elementelementor-element-t4awjqz5
px pxelementor-elementelementor-element-jdss2iu5
2 stk4
se udvalget4
410 g4
fiskeolie og4
0px 0px4
5 stk4
der er4
px pxelementor-elementelementor-element-blqyv3o4
200 g4
daglig dosis4
natur drogeriet4
kurv kosttilskud4
stk gikisa4
px pxpadding1em4
1em 0emborder-radiuspx4
gikisa kirsebrsaft4
fra sure4
sure kirsebr4
0emborder-radiuspx px4
kirsebr fra4
px pxelementor-elementelementor-element-jf9wr9p4
pxpadding1em 0em4
0px 6px4
px pxelementor-elementelementor-element-gkyxon04
6px 0pxborder-radiuspx4
0pxborder-radiuspx px4
og tilsat3
fedtsyrer fra3
omega-3 fedtsyrer3
kombination af3
tilsat gla3
gla gamma3
dha omega-33
gamma linolensyre3
fra fiskeolie3
forhold til3
til dha3
af epa3
indhold af3
afbalanceret indhold3
hjere afbalanceret3
naturligt hjere3
et naturligt3
med et3
fedtsyrer med3
flerumttede fedtsyrer3
fra kmpenatlysolie3
essentielle flerumttede3
af essentielle3
linolensyre fra3
medvirke til3
kmpenatlysolie omega-63
den anbefalede3
og medvirke3
poteket 4900kr3
bedre svn3
fra terranova3
nova terra3
ikke trde3
kosttilskud br3
srlig kombination3
ikke overskrides3
dosis br3
daglige dosis3
anbefalede daglige3
kosttilskud den3
omega-6 fedtsyrerkapselskallen3
4 stk3
til bedre3
mlkesyrede grntsager3
kosher obligatorisk3
og kosher3
halal og3
certificeret halal3
er certificeret3
oksegelatine der3
af oksegelatine3
fremstillet af3
er fremstillet3
fedtsyrerkapselskallen er3
overskrides kosttilskud3
dosis 13
epadhagla fiskeolie3
px pxelementor-elementelementor-element-orl94ab3
px pxelementor-elementelementor-element-z78b3sx3
pxelementor-elementelementor-element-z78b3sx elementor-widget-containermarginpx3
px pxelementor-elementelementor-element-wu6j5713
px pxelementor-elementelementor-element-yuroj6x3
px pxelementor-elementelementor-element-6wunw453
pxelementor-elementelementor-element-6wunw45 elementor-widget-containermarginpx3
px pxelementor-elementelementor-element-k9dsvpb3
pxelementor-elementelementor-element-tsre92z elementor-widget-containermarginpx3
px pxelementor-elementelementor-element-jgeqbd33
px pxelementor-elementelementor-element-zq14hdp3
px pxelementor-elementelementor-element-8qb1e9m3
px pxelementor-elementelementor-element-nfapcvn3
px pxelementor-elementelementor-element-caljlfg3
px pxelementor-elementelementor-element-3aop8rc3
px pxelementor-elementelementor-element-4ibsv613
px pxelementor-elementelementor-element-tsre92z3
tilbud -2000kr3
elementor-buttonmargin-toppxelementor-elementelementor-element-gkyxon0 elementor-widget-containermarginpx3
log ind3
og kosmetik3
produkter og3
amp mineraler3
px pxelementor-elementelementor-element-85fuan63
pxelementor-elementelementor-element-gkyxon0 elementor-iqit-banner3
px pxelementor-elementelementor-element-lizdmp03
px pxelementor-elementelementor-element-nlqavbr3
0px 20px3
0pxpaddingpx px3
px pxelementor-elementelementor-element-q8e2qno3
px pxelementor-elementelementor-element-rqh8x8g3
pxelementor-elementelementor-element-rqh8x8g elementor-widget-containermarginpx3
px pxelementor-elementelementor-element-mg2oo0d3
px pxelementor-elementelementor-element-8nbti7n3
px pxelementor-elementelementor-element-sptdllu3
mlkesyrebakterierer probiotic3
kosttilskud eye3
min fr3
1 tsk3
vand og3
og lad3
lad st3
st 153
15 min3
fr indtagelse3
dagligt opls3
indtagelse mngde3
nordic naturals3
dha bidrager3
bidrager til3
mngde 2003
200 ml3
opls 13
teske dagligt3
nds nds3
til genskabelse3
10 udvalgte3
udvalgte bakteriestammer3
bakteriestammer til3
til fordjelsen3
fordjelsen tarmflorabakterier3
pulverform til3
genskabelse og3
1 teske3
og vedligeholdelse3
vedligeholdelse af3
af et3
et sundt3
sundt fordjelsessystem3
fordjelsessystem anbefalet3
anbefalet daglig3
med 53
px542
pxpaddingpx89
elementor-widget-containermarginpx73
og58
til41
kurv33
p30
af30
lg30
amp29
fra26
1px26
kosttilskud25
elementor-element-populatedmarginpx22
tilbud20
med18
0px16
pxborder-radiuspx16
er16
mad16
elementor-iqit-banner16
g15
stk15
drikke15
natur14
du11
mngde10
2em10
et10
20px9
eye9
poteket9
elementor-iqit-banner-titlemarginpx9
09
0em9
q9
te9
18
ml8
kapsler8
dosis8
indhold8
elementor-iqit-banner-contentpaddingpx8
br8
28
pxmarginpx8
kirsebrsaft8
terra8
1em7
den7
nova7
fiskeolie7
kun7
var7
ikke7
ellegrden7
elementor-background-overlayborder-radiuspx7
elementor-element-populatedborder-radiuspx7
fedtsyrer7
gikisa6
4900kr6
eller6
36
stevns6
nds6
henna6
pxpadding0px6
46
56
pxpadding2em6
66
dha6
complex6
elementor-button6
tekst6
obligatorisk6
dagligt6
daglig5
som5
ingredienser5
mg5
udvalget5
grntsager5
om5
pxelementor-elementelementor-element-t4awjqz5
hudpleje5
pxelementor-elementelementor-element-jdss2iu5
din5
pxelementor-elementelementor-element-7asouq85
kirsebr4
sure4
ny4
0rem4
b4
brug4
fr4
der4
epa4
74
box4
bag4
0pxborder-radiuspx4
produkter4
barn4
6px4
liter4
terranova4
84
koster4
0emborder-radiuspx4
magnifood4
stort4
solaray4
se4
kohlosseum4
pxpadding1em4
mineraler4
pxelementor-elementelementor-element-gkyxon04
pxelementor-elementelementor-element-blqyv3o4
drogeriet4
pxelementor-elementelementor-element-jf9wr9p4
94
fragt4
left4
astragalus3
laya3
pxelementor-elementelementor-element-85fuan63
pxelementor-elementelementor-element-caljlfg3
kosher3
halal3
certificeret3
oksegelatine3
fremstillet3
fedtsyrerkapselskallen3
omega-63
kmpenatlysolie3
linolensyre3
gamma3
gla3
tilsat3
omega-33
olier3
kosmetik3
helseprodukter3
svn3
flasker3
salt3
mlkesyrede3
wishlist3
raw3
sauerkraut3
vi3
kologisk3
hvedekim3
103
bestiller3
videnskabelige3
bedre3
trret3
medvirke3
your3
log3
ind3
mor3
indeholder3
afbalanceret3
trde3
overskrides3
energi3
daglige3
anbefalede3
kologiske3
forhold3
mange3
hjere3
pxelementor-elementelementor-element-yuroj6x3
pulverform3
tarmflorabakterier3
fordjelsen3
pxelementor-elementelementor-element-nlqavbr3
udvalgte3
pxelementor-elementelementor-element-tsre92z3
gram3
pxelementor-elementelementor-element-4ibsv613
probiotic3
mlkesyrebakterierer3
pxelementor-elementelementor-element-z78b3sx3
pxelementor-elementelementor-element-wu6j5713
denne3
honning3
har3
vedligeholdelse3
12000kr3
pxelementor-elementelementor-element-6wunw453
pollen3
webshop3
-2000kr3
pxelementor-elementelementor-element-orl94ab3
hos3
super3
pxelementor-elementelementor-element-k9dsvpb3
pxelementor-elementelementor-element-jgeqbd33
pxelementor-elementelementor-element-zq14hdp3
pxelementor-elementelementor-element-8qb1e9m3
pxelementor-elementelementor-element-nfapcvn3
pxelementor-elementelementor-element-sptdllu3
genskabelse3
pxelementor-elementelementor-element-8nbti7n3
naturligt3
nordic3
flerumttede3
essentielle3
kombination3
srlig3
epadhagla3
elementor-buttonmargin-toppxelementor-elementelementor-element-gkyxon03
pxelementor-elementelementor-element-lizdmp03
pxelementor-elementelementor-element-3aop8rc3
vores3
kan3
bidrager3
0pxpaddingpx3
pxelementor-elementelementor-element-q8e2qno3
naturals3
pxelementor-elementelementor-element-rqh8x8g3
sundt3
omega3
stress3
vitaminer3
indtagelse3
min3
st3
lad3
vand3
tsk3
opls3
teske3
pxelementor-elementelementor-element-mg2oo0d3
anbefalet3
fordjelsessystem3
bakteriestammer3

Who hosts Naturpoteket.dk?

Naturpoteket.dk Hosting Provider Information

Hosted IP Address:35.214.245.73
Hosted Hostname:73.245.214.35.bc.googleusercontent.com
Service Provider:Merit Network Inc.
Hosted Country:United StatesUS
Location Latitude:37.4043
Location Longitude:-122.0748
Webserver Software:nginx

Is "Merit Network Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%

HTTP Header Analysis for Naturpoteket.dk

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Thu, 03 Dec 2020 04:44:23 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
X-Httpd: 1
Host-Header: 6b7412fb82ca5edfd0917e3957f05d89
X-Proxy-Cache: MISS
X-Proxy-Cache-Info: W NC:000000 UP:1
Content-Encoding: gzip

Naturpoteket.dk Domain Nameserver Information

HostIP AddressCountry
ns2.curanet.dk 91.197.248.75
ns1.curanet.dk 185.25.141.12


Need to find out who hosts Naturpoteket.dk?


Domain Registration (WhoIs) information for Naturpoteket.dk

 # Hello 18.132.13.38. Your session has been logged.
#
# Copyright (c) 2002 - 2020 by DK Hostmaster A/S
#
# Version: 4.0.2
#
# The data in the DK Whois database is provided by DK Hostmaster A/S
# for information purposes only, and to assist persons in obtaining
# information about or related to a domain name registration record.
# We do not guarantee its accuracy. We will reserve the right to remove
# access for entities abusing the data, without notice.
#
# Any use of this material to target advertising or similar activities
# are explicitly forbidden and will be prosecuted. DK Hostmaster A/S
# requests to be notified of any such activities or suspicions thereof.

Domain: naturpoteket.dk
DNS: naturpoteket.dk
Registered: 1999-04-15
Expires: 2021-06-30
Registration period: 1 year
VID: no
DNSSEC: Unsigned delegation, no records
Status: Active

Nameservers
Hostname: ns1.curanet.dk
Hostname: ns2.curanet.dk

Websites with Similar Names

Natur-akita.com
北欧の家 ナチュール│秋田県の北欧モダンな注文住宅・新築住宅
Natur-aktiv.com
Kanutour auf der Ruhr, Kanuverleih und Events im Ruhrtal
Natur-alh.com
NaturAlh - Bienvenida
Natur-all.hu
Natur-all Kft.
Natur-ally.org
Allies Of Nature - Flower Essences, Devon UK
Natur-alp.biz
Félicitations ! Votre domaine a bien été créé chez OVH !
Natur-alp.com
Félicitations ! Votre domaine a bien été créé chez OVH !
Natur-alp.info
Félicitations ! Votre domaine a bien été créé chez OVH !

Recently Updated Websites

Feumodal.com (4 seconds ago.)Fertilityhealing.com (6 seconds ago.)Eyecandybeautyshop.com (6 seconds ago.)Feumoves.com (8 seconds ago.)Flowchemy.com (8 seconds ago.)Fanaticallyfiduciary.com (9 seconds ago.)Abovegroundnetworks.com (10 seconds ago.)Freedomfightersdc.com (11 seconds ago.)Finishedinfire.com (11 seconds ago.)Fortknoxxdispensary.com (12 seconds ago.)Freedomandwealthblueprint.com (13 seconds ago.)Fngharvest.com (14 seconds ago.)Flseedlings.com (16 seconds ago.)Delanonewyearseve.com (17 seconds ago.)Eyesopenapparel.com (18 seconds ago.)Embeddedneurons.com (21 seconds ago.)Financialavocado.com (23 seconds ago.)Farmpur.com (23 seconds ago.)Financeiraenegocios.com (23 seconds ago.)Frndstar.com (24 seconds ago.)Cofreedomwear.com (25 seconds ago.)Filecannapatent.com (25 seconds ago.)Computerhilfeesslingen.com (25 seconds ago.)Fliphouses808.com (28 seconds ago.)Diezcorporation.com (28 seconds ago.)Fourmasterswhisky.com (30 seconds ago.)Foenandrea.com (30 seconds ago.)Doceofunds.com (30 seconds ago.)Flyingblackcatclub.com (31 seconds ago.)Galteno.com (32 seconds ago.)

Recently Searched Keywords

как давать и просить деньги в долг (4 seconds ago.)scsxb (6 seconds ago.)инерционная катушка (6 seconds ago.)beach in hawaii by ziggy marley ft. just us (8 seconds ago.)常识 (9 seconds ago.)motoru optimizasyonu (10 seconds ago.)double apple vapenova flavor shot 60ml (11 seconds ago.)13被捆绑后诶的快感极品主播虐待自拍 (12 seconds ago.)uchwała nr liii (13 seconds ago.)inbsppraktycznej (14 seconds ago.)2nd us constitution (15 seconds ago.)terreno jumilla jumillaver (16 seconds ago.)mst time now (20 seconds ago.)settings slidestoshow (23 seconds ago.)18183������ (25 seconds ago.)motorola rss programming (26 seconds ago.)csstop yiburecomputelayoutheight (27 seconds ago.)knotty pine menu (28 seconds ago.)форекс (30 seconds ago.)в николаеве нук переходит на месяц дистанционного обучения (31 seconds ago.)westberg award (33 seconds ago.)bersama anggota keluarga (34 seconds ago.)cap realty, llccap realty, llccap realty, llccap realty, llc (35 seconds ago.)bibi chou (36 seconds ago.)в николаеве нук переходит на месяц дистанционного обучения (38 seconds ago.)qiubet9295 (39 seconds ago.)bayhalf (42 seconds ago.)dm hipp gl (42 seconds ago.)commercial fencing (43 seconds ago.)u0110u1ee9c (44 seconds ago.)