Nazwa.pl  |  nazwa.pl |  Hosting, Rejestracja domen, Darmowe strony WWW i Poczta - Zobacz
High trust score  | 
Domeny, serwery, strony www oraz profesjonalny hosting w nazwa.pl. Teraz w promocji możesz mieć atrakcyjny adres www, serwer i Stronę WWW zupełnie za darmo!

Nazwa.pl Website Information

Nazwa.pl has a High trust score, a Statvoo Rank of B, an Alexa Rank of 11,018, a Majestic Rank of 1,544, a Domain Authority of 93% and is not listed in DMOZ.

Nazwa.pl is hosted by nazwa.pl S.A. in Malopolskie, Krakow, Poland, 31-553.
Nazwa.pl has an IP Address of 85.128.128.36 and a hostname of nazwa.pl.

The domain nazwa.pl was registered 6 years 10 months 5 days ago by NASK, it was last modified 4 years 7 months 2 weeks ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for nazwa.pl

Full Whois Lookup for Nazwa.pl Whois Lookup

request limit exceeded

Who hosts Nazwa.pl?

Nazwa.pl Web Server Information

Hosted IP Address:85.128.128.36
Hosted Hostname:nazwa.pl
Service Provider:nazwa.pl S.A.
Hosted Country:PolandPL
Location Latitude:50.0833
Location Longitude:19.9167
Webserver Software:Not Applicable

HTTP Header Analysis for Nazwa.pl

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx/1.6.2
Date: Tue, 09 Jun 2015 11:10:02 GMT
Content-Type: text/html; charset=utf-8
Content-Length: 15776
Connection: keep-alive
Expires: Wed, 10 Jun 2015 07:33:07 GMT
ETag: "a4e4f28201617cfe4433052e72c5683d"
Cache-Control: max-age=86093, max-age=0, no-cache
Pragma: public
X-XSS-Protection: 1; mode=block
X-Frame-Options: SAMEORIGIN
X-Mod-Pagespeed: Powered By mod_pagespeed
Vary: Accept-Encoding
Content-Encoding: gzip
Accept-Ranges: bytes
Age: 12707
X-Cache: HIT


Need to find out who hosts Nazwa.pl?

Nazwa.pl Free SEO Report

Website Inpage Analysis for Nazwa.pl

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Nazwa.pl

wicej zamwsirequiredzmiesodzyska000certyfikatydlaserwerdanychgaqpushtrackeventelementyglobalnecentrumpomocynainternetsklepykolumnanewkoszykainternetowethisattrhrefbruttomies do koszykarequired truedatabreak case thisattrhrefbreakkaspersky internet securityczym jestfooterserweryjak mogpomocy czymcoinformacjigaqpushtrackeventelementyglobalnewczymmozemypomocdomenygaqpushtrackeventelementyglobalneofirmiekaspersky internetcase thisattrhrefusugizli aclickfunction switchtrueszukajswitchtrue casezacertyfikatdodatki dojakosobowychsecuritystrongbfirmjak zamwipomocyswitchtrue case thisattrhrefbruttomiesserwerwzamwiczymli aclickfunctioncentrum pomocyaclickfunctionkreatorinternet securitybreak caseprzezaclickfunction switchtrue casejestfooter col4setwdocumentreadyfunctionliodcasebruttomies do0innecfgvpsprojektz bruttomies docentrumpanelstronycloudfunctionnazwaplcol4setnewsletterpocztydanych osobowychtruecomponentnamepomocy jakwybierzmogklientwcennikzamworazsslwicejdodatkiczyaclickfunction switchtruedomenopocztaz bruttomiescentrum pomocy jaksvaremailhostingzarabiajfootercontainer footer col4setfancyboxcontentfootercontainersklepuswitchtruejudo koszykakasperskyszczegy1centrum pomocy czymdofootercontainer footer

Longtail Keyword Density for Nazwa.pl

KeywordsOccurences
break case thisattrhref16
centrum pomocy jak5
footer-container footer col4-set4
switchtrue case thisattrhref4
li aclickfunction switchtrue4
aclickfunction switchtrue case4
bruttomies do koszyka3
centrum pomocy czym3
kaspersky internet security3
z bruttomies do3
case thisattrhref20
break case16
centrum pomocy11
jak zamwi5
pomocy jak5
li aclickfunction4
aclickfunction switchtrue4
footer-container footer4
footer col4-set4
czym jest4
wicej zamw4
switchtrue case4
kaspersky internet4
required true3
z bruttomies3
pomocy czym3
jak mog3
dodatki do3
internet security3
do koszyka3
bruttomies do3
danych osobowych3
var25
break20
thisattrhref20
case20
do18
jak17
nazwapl17
od14
pomocy13
domen12
wicej11
centrum11
ssl11
jest11
o11
cennik11
na10
stron10
domeny9
danych9
zmies9
z9
gaqpushtrackeventelementyglobalneofirmie8
zamw7
dla7
usugi7
zamwi7
czym7
vps7
poczta7
required6
gaqpushtrackeventelementyglobalnewczymmozemypomoc6
za6
hosting6
fancybox-content5
true5
firm5
data5
05
panel5
strony5
serwer5
przez5
w5
si5
documentreadyfunction5
kaspersky5
footer-container4
s4
kolumna4
footer4
gb4
function4
email4
internet4
czy4
col4-set4
kreator4
ju4
mog4
gaqpushtrackeventelementyglobalnecentrumpomocy4
new4
oraz4
li4
newsletter4
switchtrue4
sklepu4
aclickfunction4
internetowe3
osobowych3
zarabiaj3
e-mail3
szukaj3
13
inne3
poczty3
odzyska3
certyfikat3
dodatki3
sklepy3
co3
0003
wybierz3
projekt3
security3
certyfikaty3
cloud3
szczegy3
bruttomies3
koszyka3
serwerw3
informacji3
serwery3
componentname3
cfg3
klientw3

What are the nameservers for nazwa.pl?

Nazwa.pl Domain Nameserver Information

HostIP AddressCountry
ns2.nazwa.pl 77.55.126.10Poland Poland
ns1.nazwa.pl 77.55.125.10Poland Poland
ns3.nazwa.pl 77.55.127.10Poland Poland

Nazwa.pl Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Nazwa.pl is a scam?