Safety: Low trust score
Year Founded: 2019
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-11
Category: This site has not been categorized yet


Domain summary

Domain label
nbinvt
Domain extension
cn
Domain registered:
2019-07-11
Domain updated:
2020-10-11
Domain expires:
2021-07-11
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is nbinvt.cn ranked relative to other sites:

Percentage of visits to nbinvt.cn from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Nbinvt.cn registered?
A: Nbinvt.cn was registered 1 year, 6 months, 1 week, 1 day, 21 hours, 11 minutes, 21 seconds ago on Thursday, July 11, 2019.
Q: When was the WHOIS for Nbinvt.cn last updated?
A: The WHOIS entry was last updated 3 months, 1 week, 1 day, 21 hours, 11 minutes, 21 seconds ago on Sunday, October 11, 2020.
Q: What are Nbinvt.cn's nameservers?
A: DNS for Nbinvt.cn is provided by the following nameservers:
  • jm1.dns.com
  • jm2.dns.com
Q: Who is the registrar for the Nbinvt.cn domain?
A: The domain has been registered at China NIC.
Q: What is the traffic rank for Nbinvt.cn?
A: Nbinvt.cn has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Nbinvt.cn each day?
A: Nbinvt.cn receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Nbinvt.cn resolve to?
A: Nbinvt.cn resolves to the IPv4 address 156.249.224.218.
Q: In what country are Nbinvt.cn servers located in?
A: Nbinvt.cn has servers located in the United States.
Q: What webserver software does Nbinvt.cn use?
A: Nbinvt.cn is powered by Microsoft-IIS/7.5 webserver.
Q: Who hosts Nbinvt.cn?
A: Nbinvt.cn is hosted by MTN Business Solutions in United States.
Q: How much is Nbinvt.cn worth?
A: Nbinvt.cn has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Nbinvt.cn Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Nbinvt.cn Free SEO Report

Website Inpage Analysis for Nbinvt.cn

H1 Headings

0 :

H2 Headings

0 :

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

0 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

0:

Links - Internal (nofollow)

0:

Links - Outbound

0:

Links - Outbound (nofollow)

0:

Keyword Cloud for Nbinvt.cn

d0d0d0positionabsolutedisplaynoneleft0paddingtop10pxpaddingbottom10pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngnavlayer7fd9ac5e25faa0737b85d96812a85091 ul liullazyloadingabtnareahoverfunctionliwpsubtopahovertextdecorationnonefontsize14pxfontfamilyarialcolor333textalignleftfontweightnormalfontstylenormalsolid d0d0d0positionabsolutedisplaynoneleft0paddingtop10pxpaddingbottom10pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngoptspagewidthd0d0d0paddingleft10pxpaddingright10pxminwidth80pxwhitespacenowrapoverflowhiddendisplayblockfontsize12pxfontfamilyarialcolor666textaligncenterfontweightnormalfontstylenormalnavstyle trimlayeriddatakeynavlayer776626fe8276b7fad27bfb83bd532590navlayer0f5086d0f8cf6fa2db736d4abd106b1aliwpsubtopwidth84pxyaheiliwpsubtophovertextalignleftpaddingleft10pxpaddingright4pxheight39pxlineheight39pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationstylesverticalvs7h22056dt2jpgbackgroundrepeatrepeatxbackgroundpositiontopul li aborderbottom1pxyahei navlayer7fd9ac5e25faa0737b85d96812a85091fullwidth fullwidthcssleft0canvasoffsetleftscrollcontaineroffsetleftscrollcontainerscrollleftparseintegercanvascssborderleftwidthwidthscrollcontainerbgwidth functionul li ahovertextaligncenterfontsize12pxfontfamilyarialcolor333fontweightnormalfontstylenormalnonelipaddingleft10pxpaddingright10pxmargintop1pxtextaligncenterpositionrelativeheight33pxlineheight33pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngbackgroundrepeatrepeatxbackgroundpositiontop leftbackgroundcolortransparentreturn navstylevarsolid d0d0d0floatleftclearleftpaddingleft10pxpaddingright4pxpaddingbottom0zindex1000positionrelativewidth178pxheight39pxlineheight39pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationstylesverticalvs7h2303z96rjpgbackgroundrepeatrepeatxbackgroundpositiontopliliststyletypenonemargin0padding0borderthin noneabsoluteleftbackgroundcolortransparent navlayerc8e39da1c49f5cd8e0b48b5707e2d0e2else thisfindspanbuttonbtndefaultlabelshowtrimlayeriddatakey return navstylecontentcopenliveclickfunctiontrimlayeriddatakey returnabtnareahoverfunction ifbhflag thisfindspanbuttonbtndefaultlabelhidefalsenavlayer776626fe8276b7fad27bfb83bd532590 ul lifullwidthcssleft0canvasoffsetleftscrollcontaineroffsetleftscrollcontainerscrollleftparseintegercanvascssborderleftwidthwidthscrollcontainerbgwidth functionbgflagfunction ifbgflagvar bhflag 0else thisfindspanbuttonbtndefaultlabelshow functionutf8contentcopenliveclickfunction thisclosestfullcolumnhide varthisfindspanbuttonbtndefaultlabelhide else thisfindspanbuttonbtndefaultlabelshowvar bgflagnavlayer0f5086d0f8cf6fa2db736d4abd106b1a ul licontroltopliwpsubtopawhitespace nowrapdisplayblockpadding0textdecorationnoneoverflowhiddenfontsize14pxfontfamilyarialcolor333textalignleftfontweightnormalfontstylenormalyahei navlayer776626fe8276b7fad27bfb83bd532590 ulcharsetthisclosestfullcolumnhide varul lihovertextaligncenterheight33pxlineheight33pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngbackgroundrepeatrepeatxbackgroundpositiontop leftbackgroundcolorf1f1f1li aborderbottom1pxpopupnavlayer0f5086d0f8cf6fa2db736d4abd106b1a ulul lipaddingleft10pxpaddingright10pxmargintop1pxtextaligncenterpositionrelativeheight33pxlineheight33pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngbackgroundrepeatrepeatxbackgroundpositiontopleftbackgroundcolortransparent navlayer0f5086d0f8cf6fa2db736d4abd106b1aifbgflag thisfindspanbuttonbtndefaultlabelhideliwpsubtophoverbackgroundcolortransparentliwpsubtopafontfamilymicrosoftleftbackgroundrepeatrepeat navlayer776626fe8276b7fad27bfb83bd532590navlayerc8e39da1c49f5cd8e0b48b5707e2d0e2maxliheightelseliwpsubtopahoverfontfamilymicrosoft yaheilid0d0d0floatleftclearleftpaddingleft10pxpaddingright4pxpaddingbottom0zindex1000positionrelativewidth178pxheight39pxlineheight39pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationstylesverticalvs7h2303z96rjpgbackgroundrepeatrepeatxbackgroundpositiontop leftbackgroundcolortransparenttextalignleftliwpsubtopahoverfontfamilymicrosoft0 varliwpsubtophoverlineheight30pxliwpsubtophoverheight30pxulborder1pxwpgetnavstylelayeridkey var navstyleliwpsubtopafontfamilymicrosoft yaheiahovertextaligncenterfontsize12pxfontfamilyarialcolor333fontweightnormalfontstylenormalaborderbottom1px solidliwpsubtopheight30pxifbgflag thisfindspanbuttonbtndefaultlabelhide elseliwpsubtopborderbottom1px solid d0d0d0floatleftclearleftpaddingleft10pxpaddingright4pxpaddingbottom0zindex1000positionrelativewidth178pxheight39pxlineheight39pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationstylesverticalvs7h2303z96rjpgbackgroundrepeatrepeatxbackgroundpositiontopyahei navlayer0f5086d0f8cf6fa2db736d4abd106b1aliwpsubtopborderbottom1pxfunctionliwpsubtopawhitespaced0d0d0floatleftclearleftpaddingleft10pxpaddingright4pxpaddingbottom0zindex1000positionrelativewidth178pxheight39pxlineheight39pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationstylesverticalvs7h2303z96rjpgbackgroundrepeatrepeatxbackgroundpositiontopliwidthwpgetnavstylelayeridkeyul li0ulborder1px solidnavstylepositionfunction wpgetnavstylelayeridkeyli ahovertextaligncenterfontsize12pxfontfamilyarialcolor333fontweightnormalfontstylenormalliwpsubtopbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngleftbackgroundcolortransparenttextalignleftabtnarealeftbackgroundcolorf1f1f1leftbackgroundrepeatrepeatcontentcopenliveclickfunction thisclosestfullcolumnhideifbhflag thisfindspanbuttonbtndefaultlabelhidemgnrightvar bgflag 0padding0pxabtnareahoverfunction ifbhflagsolid d0d0d0floatleftclearleftpaddingleft10pxpaddingright4pxpaddingbottom0zindex1000positionrelativewidth178pxheight39pxlineheight39pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationstylesverticalvs7h2303z96rjpgbackgroundrepeatrepeatxbackgroundpositiontop leftbackgroundcolortransparenttextalignleftleftbackgroundrepeatrepeat navlayer776626fe8276b7fad27bfb83bd532590 ulyahei navlayer781eb42e8e1f22793d8c6dc129065dfanavlayer781eb42e8e1f22793d8c6dc129065dfa ul lithisfindspanbuttonbtndefaultlabelhideaborderbottom1pxfunction wpgetnavstylelayeridkey varsolidul lihovertextaligncenterheight33pxlineheight33pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngbackgroundrepeatrepeatxbackgroundpositiontopnavstyle trimlayeriddatakey returnlihovertextaligncenterheight33pxlineheight33pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngbackgroundrepeatrepeatxbackgroundpositiontop leftbackgroundcolorf1f1f1navlayerc8e39da1c49f5cd8e0b48b5707e2d0e2 ul li0 var bhflagskin3solid d0d0d0paddingleft10pxpaddingright10pxminwidth80pxwhitespacenowrapoverflowhiddendisplayblockfontsize12pxfontfamilyarialcolor666textaligncenterfontweightnormalfontstylenormalspansub1paddingright10pxulborder1px solid d0d0d0positionabsolutedisplaynoneleft0paddingtop10pxpaddingbottom10pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngulbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngnewtitlebgflag 0 varliwpsubtopacolor666666 function wpgetnavstylelayeridkeyifbhflag thisfindspanbuttonbtndefaultlabelhide elsebhflagyahei navlayerc8e39da1c49f5cd8e0b48b5707e2d0e2var navstylefullwidthbhflag 0thisfindspanbuttonbtndefaultlabelshow functionmliwpsubtophoverbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngliliststyletypenonemargin0padding0borderthinfunction varbgflag 0thisfindspanbuttonbtndefaultlabelshow function ifbgflagthisfindspanbuttonbtndefaultlabelshowtextdecorationcharset utf8li aborderbottom1px solidabtnarea findspanbuttonbtndefaultlabelhideliwpsubtopacolor666666navlayer776626fe8276b7fad27bfb83bd532590 ulfullwidthcssleft0canvasoffsetleftscrollcontaineroffsetleftscrollcontainerscrollleftparseintegercanvascssborderleftwidthwidthscrollcontainerbgwidth function varkfullwidthcssleft0canvasoffsetleftscrollcontaineroffsetleftscrollcontainerscrollleftparseintegercanvascssborderleftwidthwidthscrollcontainerbgwidthvar navstyle trimlayeriddatakeynavlayer781eb42e8e1f22793d8c6dc129065dfa ulfunction ifbgflag thisfindspanbuttonbtndefaultlabelhideul ulbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngyahei navlayer776626fe8276b7fad27bfb83bd532590liwpsubtopbackgroundcolortransparentliwpsubtopborderbottom1px solidleftbackgroundcolortransparentnavlayer7fd9ac5e25faa0737b85d96812a85091thisclosestfullcolumnhideleftbackgroundcolortransparent navlayer781eb42e8e1f22793d8c6dc129065dfathisfindspanbuttonbtndefaultlabelhide elsenowrapdisplayblockpadding0textdecorationnoneoverflowhiddenfontsize14pxfontfamilyarialcolor333textalignleftfontweightnormalfontstylenormallihovertextaligncenterheight33pxlineheight33pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngbackgroundrepeatrepeatxbackgroundpositiontopaborderbottom1px solid d0d0d0paddingleft10pxpaddingright10pxminwidth80pxwhitespacenowrapoverflowhiddendisplayblockfontsize12pxfontfamilyarialcolor666textaligncenterfontweightnormalfontstylenormalfullcolumnbgvideoinitfuncvideoparamslipaddingleft10pxpaddingright10pxmargintop1pxtextaligncenterpositionrelativeheight33pxlineheight33pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngbackgroundrepeatrepeatxbackgroundpositiontopfindspanbuttonbtndefaultlabelhideliwpsubtoplineheight30pxwpgetnavstylelayeridkey varreturn0 ifbgflagmaxcolsnavlayer7fd9ac5e25faa0737b85d96812a85091 ulifbgflagcontrollefttrimlayeriddatakeybhflag 0 ifbgflagleftbackgroundcolortransparent navlayer7fd9ac5e25faa0737b85d96812a85091ifbhflagvar bhflagiful lipaddingleft10pxpaddingright10pxmargintop1pxtextaligncenterpositionrelativeheight33pxlineheight33pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngbackgroundrepeatrepeatxbackgroundpositiontop leftbackgroundcolortransparentliwpsubtophovertextalignleftpaddingleft10pxpaddingright4pxheight39pxlineheight39pxbackgroundimageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationstylesverticalvs7h22056dt2jpgbackgroundrepeatrepeatxbackgroundpositiontop leftbackgroundcolortransparentnavlayerc8e39da1c49f5cd8e0b48b5707e2d0e2 ulliwpsubtopacolor666666 functionm functionfullwidth fullwidthcssleft0canvasoffsetleftscrollcontaineroffsetleftscrollcontainerscrollleftparseintegercanvascssborderleftwidthwidthscrollcontainerbgwidthnavlayer781eb42e8e1f22793d8c6dc129065dfa

Longtail Keyword Density for Nbinvt.cn

KeywordsOccurences
navlayer776626fe8276b7fad27bfb83bd532590 ul li18
thisfindspanbuttonbtndefault-labelhide else thisfindspanbuttonbtndefault-labelshow12
li aborder-bottom1px solid8
ul li aborder-bottom1px8
ul lihovertext-aligncenterheight33pxline-height33pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngbackground-repeatrepeat-xbackground-positiontop leftbackground-colorf1f1f18
ul lipadding-left10pxpadding-right10pxmargin-top1pxtext-aligncenterpositionrelativeheight33pxline-height33pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngbackground-repeatrepeat-xbackground-positiontop leftbackground-colortransparent8
ulborder1px solid d0d0d0positionabsolutedisplaynoneleft0padding-top10pxpadding-bottom10pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpng8
solid d0d0d0floatleftclearleftpadding-left10pxpadding-right4pxpadding-bottom0z-index1000positionrelativewidth178pxheight39pxline-height39pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationstylesverticalvs7h2303z96rjpgbackground-repeatrepeat-xbackground-positiontop leftbackground-colortransparenttext-alignleft8
liwpsubtopborder-bottom1px solid d0d0d0floatleftclearleftpadding-left10pxpadding-right4pxpadding-bottom0z-index1000positionrelativewidth178pxheight39pxline-height39pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationstylesverticalvs7h2303z96rjpgbackground-repeatrepeat-xbackground-positiontop8
ul li ahovertext-aligncenterfont-size12pxfont-familyarialcolor333font-weightnormalfont-stylenormal8
aborder-bottom1px solid d0d0d0padding-left10pxpadding-right10pxmin-width80pxwhite-spacenowrapoverflowhiddendisplayblockfont-size12pxfont-familyarialcolor666text-aligncenterfont-weightnormalfont-stylenormal8
ifbgflag thisfindspanbuttonbtndefault-labelhide else6
function ifbgflag thisfindspanbuttonbtndefault-labelhide6
thisfindspanbuttonbtndefault-labelshow function ifbgflag6
ifbhflag thisfindspanbuttonbtndefault-labelhide else6
else thisfindspanbuttonbtndefault-labelshow function6
abtnareahoverfunction ifbhflag thisfindspanbuttonbtndefault-labelhide6
var bhflag 06
0 var bhflag6
bgflag 0 var6
var bgflag 06
bhflag 0 ifbgflag6
function wpgetnavstylelayeridkey var5
trimlayeriddatakey return navstyle5
navstyle trimlayeriddatakey return5
var navstyle trimlayeriddatakey5
wpgetnavstylelayeridkey var navstyle5
navlayer781eb42e8e1f22793d8c6dc129065dfa ul li4
navlayer7fd9ac5e25faa0737b85d96812a85091 ul li4
yahei navlayer776626fe8276b7fad27bfb83bd532590 ul4
navlayer0f5086d0f8cf6fa2db736d4abd106b1a ul li4
leftbackground-repeatrepeat navlayer776626fe8276b7fad27bfb83bd532590 ul4
fullwidthcssleft0-canvasoffsetleftscrollcontaineroffsetleft-scrollcontainerscrollleft-parseintegercanvascssborderleftwidthwidthscrollcontainerbgwidth function var4
fullwidth fullwidthcssleft0-canvasoffsetleftscrollcontaineroffsetleft-scrollcontainerscrollleft-parseintegercanvascssborderleftwidthwidthscrollcontainerbgwidth function4
contentcopenliveclickfunction thisclosestfullcolumnhide var4
navlayerc8e39da1c49f5cd8e0b48b5707e2d0e2 ul li4
liwpsubtopacolor666666 function wpgetnavstylelayeridkey3
navlayer776626fe8276b7fad27bfb83bd532590 ul38
ul li34
thisfindspanbuttonbtndefault-labelhide else12
else thisfindspanbuttonbtndefault-labelshow12
charset utf-810
navlayerc8e39da1c49f5cd8e0b48b5707e2d0e2 ul10
liwpsubtopafont-familymicrosoft yahei10
navlayer0f5086d0f8cf6fa2db736d4abd106b1a ul10
liwpsubtopahoverfont-familymicrosoft yahei10
navlayer7fd9ac5e25faa0737b85d96812a85091 ul10
navlayer781eb42e8e1f22793d8c6dc129065dfa ul10
solid d0d0d0positionabsolutedisplaynoneleft0padding-top10pxpadding-bottom10pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpng8
ulborder1px solid8
d0d0d0floatleftclearleftpadding-left10pxpadding-right4pxpadding-bottom0z-index1000positionrelativewidth178pxheight39pxline-height39pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationstylesverticalvs7h2303z96rjpgbackground-repeatrepeat-xbackground-positiontop leftbackground-colortransparenttext-alignleft8
liwpsubtopawhite-space nowrapdisplayblockpadding0text-decorationnoneoverflowhiddenfont-size14pxfont-familyarialcolor333text-alignleftfont-weightnormalfont-stylenormal8
liwpsubtophovertext-alignleftpadding-left10pxpadding-right4pxheight39pxline-height39pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationstylesverticalvs7h22056dt2jpgbackground-repeatrepeat-xbackground-positiontop leftbackground-colortransparent8
lipadding-left10pxpadding-right10pxmargin-top1pxtext-aligncenterpositionrelativeheight33pxline-height33pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngbackground-repeatrepeat-xbackground-positiontop leftbackground-colortransparent8
lilist-style-typenonemargin0padding0borderthin none8
ul lipadding-left10pxpadding-right10pxmargin-top1pxtext-aligncenterpositionrelativeheight33pxline-height33pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngbackground-repeatrepeat-xbackground-positiontop8
function var8
ul lihovertext-aligncenterheight33pxline-height33pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngbackground-repeatrepeat-xbackground-positiontop8
lihovertext-aligncenterheight33pxline-height33pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngbackground-repeatrepeat-xbackground-positiontop leftbackground-colorf1f1f18
liwpsubtopborder-bottom1px solid8
li aborder-bottom1px8
aborder-bottom1px solid8
solid d0d0d0padding-left10pxpadding-right10pxmin-width80pxwhite-spacenowrapoverflowhiddendisplayblockfont-size12pxfont-familyarialcolor666text-aligncenterfont-weightnormalfont-stylenormal8
li ahovertext-aligncenterfont-size12pxfont-familyarialcolor333font-weightnormalfont-stylenormal8
ul ulbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpng8
yahei navlayer776626fe8276b7fad27bfb83bd5325908
solid d0d0d0floatleftclearleftpadding-left10pxpadding-right4pxpadding-bottom0z-index1000positionrelativewidth178pxheight39pxline-height39pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationstylesverticalvs7h2303z96rjpgbackground-repeatrepeat-xbackground-positiontop8
0 var7
leftbackground-colortransparent navlayer781eb42e8e1f22793d8c6dc129065dfa6
leftbackground-colortransparent navlayer7fd9ac5e25faa0737b85d96812a850916
leftbackground-colortransparent navlayerc8e39da1c49f5cd8e0b48b5707e2d0e26
ifbgflag thisfindspanbuttonbtndefault-labelhide6
leftbackground-colortransparent navlayer0f5086d0f8cf6fa2db736d4abd106b1a6
bhflag 06
function ifbgflag6
bgflag 06
var bhflag6
var bgflag6
0 ifbgflag6
abtnarea findspanbuttonbtndefault-labelhide6
abtnareahoverfunction ifbhflag6
ifbhflag thisfindspanbuttonbtndefault-labelhide6
thisfindspanbuttonbtndefault-labelshow function6
navstyle trimlayeriddatakey5
function wpgetnavstylelayeridkey5
return navstyle5
wpgetnavstylelayeridkey var5
var navstyle5
trimlayeriddatakey return5
leftbackground-repeatrepeat navlayer776626fe8276b7fad27bfb83bd5325904
yahei navlayer7fd9ac5e25faa0737b85d96812a850914
yahei navlayer781eb42e8e1f22793d8c6dc129065dfa4
contentcopenliveclickfunction thisclosestfullcolumnhide4
m function4
yahei navlayer0f5086d0f8cf6fa2db736d4abd106b1a4
thisclosestfullcolumnhide var4
fullwidth fullwidthcssleft0-canvasoffsetleftscrollcontaineroffsetleft-scrollcontainerscrollleft-parseintegercanvascssborderleftwidthwidthscrollcontainerbgwidth4
fullwidthcssleft0-canvasoffsetleftscrollcontaineroffsetleft-scrollcontainerscrollleft-parseintegercanvascssborderleftwidthwidthscrollcontainerbgwidth function4
yahei navlayerc8e39da1c49f5cd8e0b48b5707e2d0e24
liwpsubtopacolor666666 function3
navlayer776626fe8276b7fad27bfb83bd53259094
ul80
var79
function48
navlayer7fd9ac5e25faa0737b85d96812a8509146
navlayer781eb42e8e1f22793d8c6dc129065dfa46
navlayer0f5086d0f8cf6fa2db736d4abd106b1a46
navlayerc8e39da1c49f5cd8e0b48b5707e2d0e246
li36
yahei24
solid24
leftbackground-colortransparent24
020
else17
if13
none12
thisfindspanbuttonbtndefault-labelhide12
ifbgflag12
thisfindspanbuttonbtndefault-labelshow12
liwpsubtopafont-familymicrosoft10
liwpsubtopahoverfont-familymicrosoft10
utf-810
navstyle10
liwpsubtophoverbackground-colortransparent10
liwpsubtopbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpng10
liwpsubtopbackground-colortransparent10
charset10
d0d0d0positionabsolutedisplaynoneleft0padding-top10pxpadding-bottom10pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpng8
leftbackground-colortransparenttext-alignleft8
liwpsubtophovertext-alignleftpadding-left10pxpadding-right4pxheight39pxline-height39pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationstylesverticalvs7h22056dt2jpgbackground-repeatrepeat-xbackground-positiontop8
liwpsubtopawhite-space8
nowrapdisplayblockpadding0text-decorationnoneoverflowhiddenfont-size14pxfont-familyarialcolor333text-alignleftfont-weightnormalfont-stylenormal8
liwpsubtopahovertext-decorationnonefont-size14pxfont-familyarialcolor333text-alignleftfont-weightnormalfont-stylenormal8
ulborder1px8
leftbackground-colorf1f1f18
lipadding-left10pxpadding-right10pxmargin-top1pxtext-aligncenterpositionrelativeheight33pxline-height33pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngbackground-repeatrepeat-xbackground-positiontop8
lihovertext-aligncenterheight33pxline-height33pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpngbackground-repeatrepeat-xbackground-positiontop8
aborder-bottom1px8
d0d0d0padding-left10pxpadding-right10pxmin-width80pxwhite-spacenowrapoverflowhiddendisplayblockfont-size12pxfont-familyarialcolor666text-aligncenterfont-weightnormalfont-stylenormal8
ahovertext-aligncenterfont-size12pxfont-familyarialcolor333font-weightnormalfont-stylenormal8
ulbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpng8
spansub1padding-right10px8
liwpsubtophoverbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationviewimagespngbgpng8
liwpsubtopheight30px8
liwpsubtopline-height30px8
liwpsubtophoverheight30px8
liwpsubtophoverline-height30px8
liwpsubtopborder-bottom1px8
d0d0d0floatleftclearleftpadding-left10pxpadding-right4pxpadding-bottom0z-index1000positionrelativewidth178pxheight39pxline-height39pxbackground-imageurlhttpstaticwebsiteonlinecnwebsitepluginnewnavigationstylesverticalvs7h2303z96rjpgbackground-repeatrepeat-xbackground-positiontop8
lilist-style-typenonemargin0padding0borderthin8
abtnareahoverfunction6
bhflag6
return6
maxliheight6
liwpsubtopacolor6666666
bgflag6
abtnarea6
findspanbuttonbtndefault-labelhide6
ifbhflag6
popup6
liwpsubtopwidth84px6
wpgetnavstylelayeridkey5
trimlayeriddatakey5
m4
lazyloading4
text-decoration4
contentcopenliveclickfunction4
leftbackground-repeatrepeat4
thisclosestfullcolumnhide4
fullwidthcssleft0-canvasoffsetleftscrollcontaineroffsetleft-scrollcontainerscrollleft-parseintegercanvascssborderleftwidthwidthscrollcontainerbgwidth4
padding0px4
fullwidth4
fullcolumnbgvideoinitfuncvideoparams4
mgnright3
maxcols3
liwidth3
k3
skin33
optspagewidth3
controltop3
false3
absolute3
newtitle3
position3
controlleft3

Who hosts Nbinvt.cn?

Nbinvt.cn Hosting Provider Information

Hosted IP Address:156.249.224.218
Hosted Hostname:156.249.224.218
Service Provider:MTN Business Solutions
Hosted Country:United StatesUS
Location Latitude:37.751
Location Longitude:-97.822
Webserver Software:Microsoft-IIS/7.5

Is "MTN Business Solutions" in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
9.5100%
DoD Network Information Center
8.4509%
Google Inc.
2.8338%
Confluence Networks Inc
2.6217%
Amazon.com, Inc.
2.1737%
Namecheap, Inc.
2.1384%
TOT Public Company Limited
1.5665%
1&1 Internet AG
1.5512%
Merit Network Inc.
1.3856%
Unified Layer
1.3043%
MTN Business Solutions
0.6317%

HTTP Header Analysis for Nbinvt.cn

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Length: 211940
Content-Type: text/html; Charset=gb2312
Server: Microsoft-IIS/7.5
X-Powered-By: ASP.NET
Date: Sun, 11 Oct 2020 05:21:07 GMT

Nbinvt.cn Domain Nameserver Information

HostIP AddressCountry
jm1.dns.com 218.98.111.214
jm2.dns.com 183.253.57.200


Need to find out who hosts Nbinvt.cn?


Domain Registration (WhoIs) information for Nbinvt.cn

 Domain Name: nbinvt.cn
ROID: 20190711s10001s13859414-cn
Domain Status: clientTransferProhibited
Registrant: 赵石付
Registrant Contact Email: Login to show email
Registrar: 上海美橙科技信息发展有限公司
Name Server: jm1.dns.com
Name Server: jm2.dns.com
Registration Time: 2019-07-11 04:02:52
Expiration Time: 2021-07-11 04:02:52
DNSSEC: unsigned

Websites with Similar Names

Nbinv.net
Error 404 (Not Found)!!1
Nbinvestments.ca
NBI Funds and Performance | National Bank Investments
Nbinvestors.org
Sell to NBInvestors

Recently Updated Websites

Centrocoronavirus.org (2 seconds ago.)Scotlandsdna.com (2 seconds ago.)Coronavoces.es (3 seconds ago.)Aoabet830.vip (3 seconds ago.)Petravets.com (3 seconds ago.)Ontodvd.com (3 seconds ago.)Seattlerobotics.com (3 seconds ago.)Sincerely.net (4 seconds ago.)Barcelona-airport-shuttle.com (4 seconds ago.)Discoverlines.com (4 seconds ago.)Absence.org (4 seconds ago.)Hostaotel.com (4 seconds ago.)Meyerdirect.com (4 seconds ago.)Lecioalmeida.com (4 seconds ago.)Unionbank.mortgage (4 seconds ago.)Apollopride.ru (5 seconds ago.)Bypinaraltug.com (5 seconds ago.)Namebranclothing.com (5 seconds ago.)Blambert.co.uk (5 seconds ago.)Guo.in (5 seconds ago.)Hace.click (6 seconds ago.)Hempelgalleries.com (6 seconds ago.)Seven.info (6 seconds ago.)Moderni-spotrebice.cz (6 seconds ago.)Austindacey.com (6 seconds ago.)Bvcaps.org (6 seconds ago.)Coinkeepers.com (7 seconds ago.)Deltaroom.ru (7 seconds ago.)Woodwards.online (7 seconds ago.)Cltgroup.online (7 seconds ago.)

Recently Searched Keywords

shoes brand name (2 seconds ago.)fundamentals of computers (6 seconds ago.)petunjuk pembayaran (8 seconds ago.)880 blue lick road (8 seconds ago.)66 100 (8 seconds ago.)tours and travels in sharjah (10 seconds ago.)screen slider1 (11 seconds ago.)wuhan (11 seconds ago.)nbsp1000 ndash (14 seconds ago.)0px 54770f1px (18 seconds ago.)000066 ffcc00 (18 seconds ago.)if counter (18 seconds ago.)54770f1px (19 seconds ago.)bonkersbet (20 seconds ago.)kütle ve ağırlık (20 seconds ago.)review-content single-slide (20 seconds ago.)fizikbilimi (21 seconds ago.)29px height 33px (21 seconds ago.)1px 0px (22 seconds ago.)ennayda (22 seconds ago.)zoegrey (24 seconds ago.)xxx pregnant movies review (24 seconds ago.)violettemoure (26 seconds ago.)vickyvixxx (27 seconds ago.)very hot cock massage live (27 seconds ago.)twitter fetish lust chat (28 seconds ago.)the camdude review (28 seconds ago.)pre-intermediate course (28 seconds ago.)stockings babes review (29 seconds ago.)stocking fetish (29 seconds ago.)