Favicon Website Thumbnail
NERFC | New England Regional Fellowship Consortium
Low trust score
Last updated:2020-10-11
This site has not been categorized yet

Domain summary

Domain label
Domain extension
Domain registered:
Domain updated:
Global Traffic Rank
Statvoo Rating
Trust Score
Low Trust Score
Estimated worth
Estimated daily income
Estimated monthly income

Rank summary

How is ranked relative to other sites:

Percentage of visits to from a search engine:

Frequently Asked Questions (FAQ)

Q: When was registered?
A: was registered 12 years, 2 months, 5 days, 19 hours, 23 minutes, 32 seconds ago on Thursday, September 18, 2008.
Q: When was the WHOIS for last updated?
A: The WHOIS entry was last updated 1 month, 1 week, 5 days, 19 hours, 23 minutes, 32 seconds ago on Sunday, October 11, 2020.
Q: What are's nameservers?
A: DNS for is provided by the following nameservers:
Q: Who is the registrar for the domain?
A: The domain has been registered at Public Interest Registry.
Q: What is the traffic rank for
A: has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit each day?
A: receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does resolve to?
A: resolves to the IPv4 address
Q: In what country are servers located in?
A: has servers located in the United States.
Q: What webserver software does use?
A: is powered by Apache/2.2.15 (CentOS) webserver.
Q: Who hosts
A: is hosted by Hostway Corporation in Illinois, Chicago, United States, 60606.
Q: How much is worth?
A: has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Who hosts Hosting Provider Information

Hosted IP Address:
Service Provider:Hostway Corporation
Hosted Country:United StatesUS
Location Latitude:41.8868
Location Longitude:-87.6386
Webserver Software:Apache/2.2.15 (CentOS)

Is "Hostway Corporation" in the Top 10 Hosting Companies?

Percentage, LLC
DoD Network Information Center
5.2857%, Inc.
Confluence Networks Inc
Google Inc.
1&1 Internet AG
TOT Public Company Limited
Unified Layer
Merit Network Inc.
Hostway Corporation

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sun, 11 Oct 2020 04:03:07 GMT
Server: Apache/2.2.15 (CentOS)
X-Powered-By: PHP/5.6.40
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 2382
Connection: close
Content-Type: text/html; charset=UTF-8 Domain Nameserver Information

HostIP AddressCountry

Need to find out who hosts

Domain Registration (WhoIs) information for

 Domain Name: NERFC.ORG
Registry Domain ID: D154095790-LROR
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2020-09-03T13:01:20Z
Creation Date: 2008-09-18T15:51:53Z
Registry Expiry Date: 2023-09-18T15:51:53Z
Registrar Registration Expiration Date:
Registrar: DomainPeople, Inc.
Registrar IANA ID: 65
Registrar Abuse Contact Email: Login to show email
Abuse Contact Phone: +1.8664678929
Domain Status: clientTransferProhibited
Registrant Organization: Massachusetts Historical Society
Registrant State/Province: MA
Registrant Country: US
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form
>>> Last update of WHOIS database: 2020-10-11T04:02:01Z Free SEO Report

Website Inpage Analysis for

H1 Headings

2 :
  1. New England Regional Fellowship Consortium
  2. New England Regional Fellowship Consortium

H2 Headings

2 :
  1. Special Awards
  2. Application Process

H3 Headings

1 :

H4 Headings

1 :
  1. About the Banner Image

H5 Headings

0 :

H6 Headings

0 :


1 :

Total Images

0 :

Google Adsense

Not Applicable

Google Analytics

Not Applicable

Links - Internal (nofollow)


Links - Outbound (nofollow)


Keyword Cloud for

regionalgrantsnew englandawardsinstitutionsconsortiumcollectionsnerfcnew england regionalhistorical societymemberengland regional fellowshipmapyearnewamericanhistorymassachusetts historicalfellowshipstudiesenglandsocietytheyleastweeksspecialmassachusettsregional fellowship consortiumengland regionalregional fellowshipmassachusetts historical societyfellowship consortiumhistoricaleach Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Websites with Similar Names
NERFC | New England Regional Fellowship Consortium :: The Unofficial Source for Everything Nerf®.

Recently Updated Websites 3 seconds 4 seconds 4 seconds 5 seconds 5 seconds 5 seconds 7 seconds 7 seconds 8 seconds 8 seconds 8 seconds 9 seconds 9 seconds 9 seconds 10 seconds 10 seconds 12 seconds 12 seconds 12 seconds 12 seconds 12 seconds 13 seconds 14 seconds 14 seconds 16 seconds 16 seconds 16 seconds 16 seconds 17 seconds 17 seconds ago.