Netbiz Group - A Web Design Company in Staffordshire

Safety: Low trust score
Year Founded: 16
Global Traffic Rank: Unknown
Estimated Worth: $9
Last updated:2020-10-19

Netbiz Group is a web design company in Staffordshire specialising in web design, web development, SEO and online marketing.


Domain summary

Domain label
netbizgroup
Domain extension
co.uk
Domain registered:
16-Aug-2011
Domain updated:
12-Jul-2019
Global Traffic Rank
0
Statvoo Rating
I
Trust Score
Low Trust Score
Estimated worth
$9
Estimated daily income
$0
Estimated monthly income
$0

Rank summary

How is netbizgroup.co.uk ranked relative to other sites:

Percentage of visits to netbizgroup.co.uk from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Netbizgroup.co.uk registered?
A: Netbizgroup.co.uk was registered 9 years, 6 months, 1 week, 3 days, 18 hours, 52 minutes, 51 seconds ago on Tuesday, August 16, 2011.
Q: When was the WHOIS for Netbizgroup.co.uk last updated?
A: The WHOIS entry was last updated 1 year, 7 months, 2 weeks, 18 hours, 52 minutes, 51 seconds ago on Friday, July 12, 2019.
Q: What are Netbizgroup.co.uk's nameservers?
A: DNS for Netbizgroup.co.uk is provided by the following nameservers:
  • ns.123-reg.co.uk
  • ns2.123-reg.co.uk
Q: Who is the registrar for the Netbizgroup.co.uk domain?
A: The domain has been registered at Nominet UK.
Q: What is the traffic rank for Netbizgroup.co.uk?
A: Netbizgroup.co.uk has a Low Trust Score, and a Statvoo Rank of I.
Q: How many people visit Netbizgroup.co.uk each day?
A: Netbizgroup.co.uk receives approximately 0 visitors and 0 page impressions per day.
Q: What IP address does Netbizgroup.co.uk resolve to?
A: Netbizgroup.co.uk resolves to the IPv4 address 46.37.186.155.
Q: In what country are Netbizgroup.co.uk servers located in?
A: Netbizgroup.co.uk has servers located in the United Kingdom.
Q: What webserver software does Netbizgroup.co.uk use?
A: Netbizgroup.co.uk is powered by Apache webserver.
Q: Who hosts Netbizgroup.co.uk?
A: Netbizgroup.co.uk is hosted by UKfastnet Ltd in England, Hartlepool, United Kingdom, Ts26.
Q: How much is Netbizgroup.co.uk worth?
A: Netbizgroup.co.uk has an estimated worth of $9. An average daily income of approximately $0, which is roughly $0 per month.

Netbizgroup.co.uk Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Netbizgroup.co.uk Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Netbizgroup.co.uk

H1 Headings

1 :
  1. We're a web design company which specialises in bespoke CMS & Ecommerce websites

H2 Headings

1 :
  1. A COVID-19 Update From Team Netbiz…

H3 Headings

17 :
  1. Web Design & Web Development
  2. Hosting & Support
  3. Search Engine Optimisation
  4. Social Media & Marketing
  5. Royal Crown Derby
  6. Beswicks Legal
  7. They go above and beyond to make sure we are happy.
  8. From the Blog
  9. Junior Web Developer Vacancy
  10. Instantly informative and contemporary in design…
  11. Web Designer Vacancy
  12. PHP Developer Vacancy
  13. Meet the Coders Behind Team Netbiz!
  14. Team Netbiz Return to the Office!
  15. New Additions to Team Netbiz Arrive with a Roar…
  16. Web Designer Vacancy
  17. Get in Touch!

H4 Headings

9 :
  1. Web Design Company
  2. Web Design Company
  3. Web Design Company
  4. Web Design Company
  5. Web Development
  6. Web Design Company
  7. Web Development
  8. Web Design Company
  9. Web Design Company

H5 Headings

0 :

H6 Headings

2 :
  1. Digital Marketing Manager - Sports Tours International
  2. Digital Marketing,WJ UK

Total IFRAMEs

0 :

Total Images

24 :

Google Adsense

:
Not Applicable

Google Analytics

:
UA-9698430-51

Links - Internal

37:

Links - Internal (nofollow)

0:

Links - Outbound

4:

Links - Outbound (nofollow)

0:

Keyword Cloud for Netbizgroup.co.uk

netbiz456 7617bespoke0845 456social mediaworktelephonehostingjoin ourdesignmediayouwere038hellip webdigitalgroupdesignerteamcontacttypetype contactpointhelpclientsweb design companywebsitestype contactpoint telephonemorebusinessseojoin our teamcompanymakeyourhellip web designhavemarketingtypehellipvacancyweb designlookingweekuscontactpointnew1developengineweukwebyearsour teamvacancywebdesign companycontactpoint telephonehere0845 456 7617joinrangeservicenetbiz grouprolestudioourtheirwe havesocial0web designgoprojects0845

Who hosts Netbizgroup.co.uk?

Netbizgroup.co.uk Hosting Provider Information

Hosted IP Address:46.37.186.155
Hosted Hostname:nbz-wordpress.netbizhosting.co.uk
Service Provider:UKfastnet Ltd
Hosted Country:United KingdomGB
Location Latitude:54.7
Location Longitude:-1.25
Webserver Software:Apache

Is "UKfastnet Ltd" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
UKfastnet Ltd
0.0153%

HTTP Header Analysis for Netbizgroup.co.uk

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Mon, 19 Oct 2020 12:23:12 GMT
Server: Apache
Strict-Transport-Security: max-age=31536000; includeSubDomains; preload
Location: https://www.netbizgroup.co.uk/
Cache-Control: max-age=1728000
Expires: Sun, 08 Nov 2020 12:23:12 GMT
Content-Length: 238
Content-Type: text/html; charset=iso-8859-1

Netbizgroup.co.uk Domain Nameserver Information

HostIP AddressCountry
ns.123-reg.co.uk 212.67.202.2
ns2.123-reg.co.uk 62.138.132.21


Need to find out who hosts Netbizgroup.co.uk?


Domain Registration (WhoIs) information for Netbizgroup.co.uk

 Domain name:
netbizgroup.co.uk

Data validation:
Nominet was not able to match the registrant's name and/or address against a 3rd party source on 28-Jan-2016

Registrar:
123-Reg Limited t/a 123-reg [Tag = 123-REG]
URL: http://www.123-reg.co.uk

Relevant dates:
Registered on: 16-Aug-2011
Expiry date: 16-Aug-2021
Last updated: 12-Jul-2019

Registration status:
Registered until expiry date.

Name servers:
ns.123-reg.co.uk 212.67.202.2
ns2.123-reg.co.uk 62.138.132.21

WHOIS lookup made at 23:35:25 20-Sep-2020

--
This WHOIS information is provided for free by Nominet UK the central registry
for .uk domain names. This information and the .uk WHOIS are:

Copyright Nominet UK 1996 - 2020.

You may not access the .uk WHOIS or use any data from it except as permitted
by the terms of use available in full at https://www.nominet.uk/whoisterms,
which includes restrictions on: (A) use of the data for advertising, or its
repackaging, recompilation, redistribution or reuse (B) obscuring, removing
or hiding any or all of this notice and (C) exceeding query rate or volume
limits. The data is provided on an 'as-is' basis and may lag behind the
register. Access may be withdrawn or restricted at any time.

Websites with Similar Names

Netbian.com
妗岄潰澹佺焊 鐢佃剳妗岄潰澹佺焊 楂樻竻澹佺焊澶у叏涓嬭浇 妗岄潰鑳屾櫙鍥剧墖 褰煎哺妗岄潰
Netbible.com
Home - NET Bible
Netbiblestudy.com
NetBibleStudy.com
Netbiblestudy.net
Are You Really Sure Of Your Eternal Salvation?
Netbiblica.net
Félicitations ! Votre domaine a bien été créé chez OVH !
Netbiblio.live
netbiblio.live - Livres PDF ebook en ligne

Recently Updated Websites

Jazzie-stylez.com (3 seconds ago.)Trendingfashionstyles.com (4 seconds ago.)Thekoqueenzkitchen.com (5 seconds ago.)Beautyrestusa.org (7 seconds ago.)Linkpeck.technology (8 seconds ago.)Merrillgrinnellfuneralhomes.com (12 seconds ago.)Pinupnylon.com (13 seconds ago.)Jesusinyourpocket.org (15 seconds ago.)Jacqueslalo.com (16 seconds ago.)Amydeborajewelry.com (17 seconds ago.)Mymenslifestyle.com (19 seconds ago.)Sellingthepermianbasin.com (20 seconds ago.)Buffstteamz.com (21 seconds ago.)Pussssygalore.com (21 seconds ago.)Autocab.org (23 seconds ago.)Strateactdialogue.com (23 seconds ago.)Egisbatimentinternational.com (25 seconds ago.)Hoangtrangplastic.com (27 seconds ago.)Parisot.tech (28 seconds ago.)Statenislandvista.com (29 seconds ago.)Daytonabuscharter.com (30 seconds ago.)Misalgultekin.com (31 seconds ago.)Driverlessbattery.com (33 seconds ago.)Brookislandfuel.com (33 seconds ago.)Honest420.info (34 seconds ago.)Branch.rentals (36 seconds ago.)Vatbit.com (37 seconds ago.)Kennedykeanewedding.com (39 seconds ago.)Scuoleverdellino.it (39 seconds ago.)Ogattire.com (41 seconds ago.)

Recently Searched Keywords

2 terms and conditions (2 seconds ago.)negoacutecio (12 seconds ago.)2 cách bảo quản tôm khô chuẩn – chỉ dân trong nghề mới biếttôm khô là một nguyên liệu khá phổ biến, chế biến được rất nhiều món ăn ngon ... (18 seconds ago.)didactic (19 seconds ago.)share to facebook (20 seconds ago.)2 cách bảo quản tôm khô chuẩn – chỉ dân trong nghề mới biếttôm khô là một nguyên liệu khá phổ biến, chế biến được rất nhiều món ăn ngon ... (26 seconds ago.)电脑低音喇叭 (29 seconds ago.)2 cách bảo quản tôm khô chuẩn – chỉ dân trong nghề mới biếttôm khô là một nguyên liệu khá phổ biến, chế biến được rất nhiều món ăn ngon ... (32 seconds ago.)tn-atomcolor333333font-size13pxfont-familymontserratarialsans-serifline-height155font-weight400border-width1pxborder-radius30pxbackground-positioncenter (34 seconds ago.)content (34 seconds ago.)cellphones (35 seconds ago.)app 1 (37 seconds ago.)карбонара (38 seconds ago.)br001n (45 seconds ago.)lokasi dan peta (46 seconds ago.)anzeigen cookie-informationen (46 seconds ago.)website by in.house.media (47 seconds ago.)photo sharing (47 seconds ago.)crippled (50 seconds ago.)одноразовая посуда и упаковка (55 seconds ago.)buse (58 seconds ago.)тарелки для пиццы (58 seconds ago.)friesland (1 minute ago.)пиалы, креманки (1 minute 5 seconds ago.)ford connect çıkma direksiyon pompası (1 minute 5 seconds ago.)trigger seq (1 minute 6 seconds ago.)одноразовые перчатки и одежда (1 minute 11 seconds ago.)tn-atomcolor333333font-size13pxfont-familymontserratarialsans-serifline-height155font-weight400border-width1pxborder-radius30pxbackground-positioncenter (1 minute 12 seconds ago.)avatargroup2398042282---size-6-medium (1 minute 12 seconds ago.)avatargroup2398042282---size-6-medium (1 minute 14 seconds ago.)