Neue-verpackung.de

Website Thumbnail
Checking...
neue verpackung | Fachportal für Entscheider aus der Verpackungsbranche

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 827,834
Estimated Worth: $1,680
Last updated:2020-10-24
Category: This site has not been categorized yet

Die neue verpackung ist eine der führenden Verpackungsfachzeitschriften Europas. Schwerpunkte sind das Verpacken von Lebensmitteln, Getränken, Pharma, Kosmetik, Chemie und Non-Food.


Domain summary

Domain label
neue-verpackung
Domain extension
de
Global Traffic Rank
827,834
Statvoo Rating
H
Trust Score
Low Trust Score
Estimated worth
$1,680
Estimated daily income
$7
Estimated monthly income
$213

Rank summary

How is neue-verpackung.de ranked relative to other sites:

Percentage of visits to neue-verpackung.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Neue-verpackung.de registered?
A: Neue-verpackung.de was registered 1 month, 5 days, 10 hours, 34 minutes, 10 seconds ago on Saturday, October 24, 2020.
Q: When was the WHOIS for Neue-verpackung.de last updated?
A: The WHOIS entry was last updated 8 months, 6 days, 10 hours, 34 minutes, 10 seconds ago on Monday, March 23, 2020.
Q: What are Neue-verpackung.de's nameservers?
A: DNS for Neue-verpackung.de is provided by the following nameservers:
  • ns1.boreus.de
  • ns2.boreus.de
  • ns3.boreus.de
  • ns4.boreus.de
Q: Who is the registrar for the Neue-verpackung.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Neue-verpackung.de?
A: Neue-verpackung.de ranks 827,834 globally on Alexa. Neue-verpackung.de has a Low Trust Score, and a Statvoo Rank of H.
Q: How many people visit Neue-verpackung.de each day?
A: Neue-verpackung.de receives approximately 1,063 visitors and 2,126 page impressions per day.
Q: What IP address does Neue-verpackung.de resolve to?
A: Neue-verpackung.de resolves to the IPv4 address 208.82.73.108.
Q: In what country are Neue-verpackung.de servers located in?
A: Neue-verpackung.de has servers located in the Germany.
Q: What webserver software does Neue-verpackung.de use?
A: Neue-verpackung.de is powered by Apache webserver.
Q: Who hosts Neue-verpackung.de?
A: Neue-verpackung.de is hosted by Alaska Communications Systems Group, Inc. in Germany.
Q: How much is Neue-verpackung.de worth?
A: Neue-verpackung.de has an estimated worth of $1,680. An average daily income of approximately $7, which is roughly $213 per month.

Neue-verpackung.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Neue-verpackung.de Free SEO Report

Website Inpage Analysis for Neue-verpackung.de

H1 Headings

1 :
  1. neue verpackung - Fachportal für Entscheider aus der Verpackungsbranche

H2 Headings

27 :
  1. Faltschachtelhersteller räumen bei Verpackungs-Awards ab
  2. VDMA: Auftragseingang im August wieder im Plus
  3. Brau Beviale 2020 Special Edition findet ausschließlich digital statt
  4. Henkel treibt nachhaltige Verpackungen im Beauty Care-Portfolio voran
  5. Plastics Europe veröffentlicht Fortschrittsbericht zu Operation Clean Sweep
  6. Kann die digitale Transformation Produktionsprozesse in Krisenzeiten effizienter gestalten?
  7. Auf Kreislaufwirtschaft optimierte Verbundverpackungen
  8. Coca-Cola belohnt via App für Recycling von PET-Flaschen
  9. DS Smith kooperiert mit Transporeon und Sixfold
  10. Nachhaltige Kartonalternative für Lebensmittelschalen von Iggesund
  11. Dr. Jürgen Kuske gibt Geschäftsführung von Optima ab
  12. Der Spoonie kommt: Essbarer Löffel bei Aldi
  13. Neopac gewinnt Auszeichnung für Kosmetikverpackung
  14. Inline konventionelle und digitale Druckprozesse kombinieren
  15. Digitales Wasserzeichen für Lenor-Verpackung
  16. Pepsico Deutschland stellt 2021 auf recycelte PET-Flaschen um
  17. Andreas Zopfi ist neuer Geschäftsführer des Schweizerischen Verpackungsinstituts
  18. Neues Lifocolor-Werk erfolgreich in Betrieb
  19. Häagen-Dazs erfindet das trojanische Eis
  20. Coop investiert in nachhaltige Automationslösung für Distributionszentrum
  21. Neste, Recycling Technologies und Unilever bündeln Know-how für chemisches Recycling
  22. Andreas Koch ist neuer Bereichsleiter Druckfarben bei Zeller + Gmelin
  23. Pawi gewinnt European Carton Excellence Award
  24. Firmenverzeichnis
  25. WIPOTEC GmbH
  26. BREITNER Abfüllanlagen GmbH
  27. Habasit GmbH

H3 Headings

1 :
  1. Whitepaper

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

1 :

Total Images

67 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

190:
  1. http://neue-verpackung.de/login/
    http://neue-verpackung.de/login/
  2. Neue-verpackung neue verpackung - Fachportal für Entscheider aus der Verpackungsbranche
    http://neue-verpackung.de/
  3. Neue-verpackung Newsletter
    http://neue-verpackung.de/newsletter/
  4. Neue-verpackung Media
    http://neue-verpackung.de/mediabereich/
  5. Neue-verpackung Abo-Login
    http://neue-verpackung.de/login/
  6. Neue-verpackung Abo abschließen
    http://neue-verpackung.de/abo/
  7. Neue-verpackung Firmen-Login
    https://firmenverzeichnis.neue-verpackung.de/admin/login
  8. Neue-verpackung Als Firma registrieren
    https://firmenverzeichnis.neue-verpackung.de/admin/login
  9. http://neue-verpackung.de/
    http://neue-verpackung.de/
  10. Neue-verpackung News
    http://neue-verpackung.de/category/news/
  11. Neue-verpackung Markt + Branche
    http://neue-verpackung.de/category/news/markt-branche/
  12. Neue-verpackung Unternehmen
    http://neue-verpackung.de/category/news/unternehmen/
  13. Neue-verpackung Personen
    http://neue-verpackung.de/category/news/personen/
  14. Neue-verpackung Messen
    http://neue-verpackung.de/category/news/messen/
  15. Neue-verpackung Verpackungsmaschinen und -geräte
    http://neue-verpackung.de/category/themen/verpackungsmaschinen/
  16. Neue-verpackung Lebensmittel
    http://neue-verpackung.de/category/themen/verpackungsmaschinen/lebensmittel-vg/
  17. Neue-verpackung Pharma/Kosmetik
    http://neue-verpackung.de/category/themen/verpackungsmaschinen/pharma-kosmetik-vg/
  18. Neue-verpackung Nonfood/Chemie
    http://neue-verpackung.de/category/themen/verpackungsmaschinen/nonfood-chemie-vg/
  19. Neue-verpackung Packmittel, Packhilfsmittel, Packstoffe
    http://neue-verpackung.de/category/themen/packmittel/
  20. Neue-verpackung Lebensmittel
    http://neue-verpackung.de/category/themen/packmittel/lebensmittel-p/
  21. Neue-verpackung Pharma/Kosmetik
    http://neue-verpackung.de/category/themen/packmittel/pharma-kosmetik-p/
  22. Neue-verpackung Nonfood/Chemie
    http://neue-verpackung.de/category/themen/packmittel/nonfood-chemie-p/
  23. Neue-verpackung Verpackungsgestaltung und -design
    http://neue-verpackung.de/category/themen/verpackungsgestaltung-und-design/
  24. Neue-verpackung Technik
    http://neue-verpackung.de/category/themen/verpackungsgestaltung-und-design/technik/
  25. Neue-verpackung Packmittel
    http://neue-verpackung.de/category/themen/verpackungsgestaltung-und-design/packmittel/
  26. Neue-verpackung Produkte
    http://neue-verpackung.de/category/produkte/
  27. Neue-verpackung Ausrüstung
    http://neue-verpackung.de/category/produkte/ausruestung/
  28. Neue-verpackung Packmittel
    http://neue-verpackung.de/category/produkte/packmittel-neue-produkte/
  29. Neue-verpackung Veranstaltungen
    http://neue-verpackung.de/veranstaltungen/
  30. Neue-verpackung Firmen
    http://neue-verpackung.de/firmen/
  31. Neue-verpackung Marktübersichten
    https://marktuebersichten.neue-verpackung.de
  32. Neue-verpackung Stellenmarkt
    http://neue-verpackung.de/stellenmarkt/
  33. Neue-verpackung Neue Produkte
    http://neue-verpackung.de/category/produkte/
  34. Neue-verpackung Webinare
    http://neue-verpackung.de/webinar/
  35. Neue-verpackung Whitepaper
    http://neue-verpackung.de/whitepaper/
  36. Neue-verpackung Heftarchiv
    http://neue-verpackung.de/hefte/
  37. Neue-verpackung Gesamtarchiv
    http://neue-verpackung.de/gesamtarchiv/
  38. Neue-verpackung Specials
    http://neue-verpackung.de/special/
  39. Neue-verpackung Umfragen
    http://neue-verpackung.de/umfrage-archiv/
  40. http://neue-verpackung.de/66420/faltschachtelhersteller-raeumen-bei-verpackungs-awards-ab/
    http://neue-verpackung.de/66420/faltschachtelhersteller-raeumen-bei-verpackungs-awards-ab/
  41. Neue-verpackung Auszeichnung Faltschachtelhersteller räumen bei Verpackungs-Awards ab
    http://neue-verpackung.de/66420/faltschachtelhersteller-raeumen-bei-verpackungs-awards-ab/
  42. https://www.neue-verpackung.de/digitale-messe/
    https://www.neue-verpackung.de/digitale-messe/
  43. http://neue-verpackung.de/66412/vdma-auftragseingang-im-august-wieder-im-plus/
    http://neue-verpackung.de/66412/vdma-auftragseingang-im-august-wieder-im-plus/
  44. Neue-verpackung Verpackungsmaschinenbau VDMA: Auftragseingang im August wieder im Plus
    http://neue-verpackung.de/66412/vdma-auftragseingang-im-august-wieder-im-plus/
  45. http://neue-verpackung.de/nachhaltigkeit-2019/
    http://neue-verpackung.de/nachhaltigkeit-2019/
  46. http://neue-verpackung.de/66407/braubeviale-2020-special-edition-findet-ausschliesslich-digital-statt/
    http://neue-verpackung.de/66407/braubeviale-2020-special-edition-findet-ausschliesslich-digital-statt/
  47. Neue-verpackung Messe Brau Beviale 2020 Special Edition findet ausschließlich digital statt
    http://neue-verpackung.de/66407/braubeviale-2020-special-edition-findet-ausschliesslich-digital-statt/
  48. http://neue-verpackung.de/66426/henkel-treibt-nachhaltige-verpackungen-im-beauty-care-portfolio-voran/
    http://neue-verpackung.de/66426/henkel-treibt-nachhaltige-verpackungen-im-beauty-care-portfolio-voran/
  49. Neue-verpackung Kreislaufwirtschaft Henkel treibt nachhaltige Verpackungen im Beauty Care-Portfolio voran
    http://neue-verpackung.de/66426/henkel-treibt-nachhaltige-verpackungen-im-beauty-care-portfolio-voran/
  50. http://neue-verpackung.de/66425/plastics-europe-veroeffentlicht-fortschrittsbericht-zu-operation-clean-sweep/
    http://neue-verpackung.de/66425/plastics-europe-veroeffentlicht-fortschrittsbericht-zu-operation-clean-sweep/
  51. Neue-verpackung Projekt gegen Granulatverluste Plastics Europe veröffentlicht Fortschrittsbericht zu Operation Clean Sweep
    http://neue-verpackung.de/66425/plastics-europe-veroeffentlicht-fortschrittsbericht-zu-operation-clean-sweep/
  52. http://neue-verpackung.de/66408/kann-die-digitale-transformation-produktionsprozesse-in-krisenzeiten-effizienter-gestalten/
    http://neue-verpackung.de/66408/kann-die-digitale-transformation-produktionsprozesse-in-krisenzeiten-effizienter-gestalten/
  53. Neue-verpackung Digitale Transformation Kann die digitale Transformation Produktionsprozesse in Krisenzeiten effizienter gestalten?
    http://neue-verpackung.de/66408/kann-die-digitale-transformation-produktionsprozesse-in-krisenzeiten-effizienter-gestalten/
  54. http://neue-verpackung.de/66424/auf-kreislaufwirtschaft-optimierte-verbundverpackungen/
    http://neue-verpackung.de/66424/auf-kreislaufwirtschaft-optimierte-verbundverpackungen/
  55. Neue-verpackung Rezyklat-Qualität Auf Kreislaufwirtschaft optimierte Verbundverpackungen
    http://neue-verpackung.de/66424/auf-kreislaufwirtschaft-optimierte-verbundverpackungen/
  56. http://neue-verpackung.de/66423/coca-cola-belohnt-via-app-fuer-recycling-von-pet-flaschen/
    http://neue-verpackung.de/66423/coca-cola-belohnt-via-app-fuer-recycling-von-pet-flaschen/
  57. Neue-verpackung Kreislaufwirtschaft Coca-Cola belohnt via App für Recycling von PET-Flaschen
    http://neue-verpackung.de/66423/coca-cola-belohnt-via-app-fuer-recycling-von-pet-flaschen/
  58. http://neue-verpackung.de/66421/ds-smith-kooperiert-mit-transporeon-und-sixfold/
    http://neue-verpackung.de/66421/ds-smith-kooperiert-mit-transporeon-und-sixfold/
  59. Neue-verpackung Daten in Echtzeit DS Smith kooperiert mit Transporeon und Sixfold
    http://neue-verpackung.de/66421/ds-smith-kooperiert-mit-transporeon-und-sixfold/
  60. http://neue-verpackung.de/66419/nachhaltige-kartonalternative-fuer-lebensmittelschalen-von-iggesund/
    http://neue-verpackung.de/66419/nachhaltige-kartonalternative-fuer-lebensmittelschalen-von-iggesund/
  61. Neue-verpackung Verpackungsschalen Nachhaltige Kartonalternative für Lebensmittelschalen von Iggesund
    http://neue-verpackung.de/66419/nachhaltige-kartonalternative-fuer-lebensmittelschalen-von-iggesund/
  62. http://neue-verpackung.de/66418/dr-juergen-kuske-gibt-geschaeftsfuehrung-von-optima-ab/
    http://neue-verpackung.de/66418/dr-juergen-kuske-gibt-geschaeftsfuehrung-von-optima-ab/
  63. Neue-verpackung Personalie Dr. Jürgen Kuske gibt Geschäftsführung von Optima ab
    http://neue-verpackung.de/66418/dr-juergen-kuske-gibt-geschaeftsfuehrung-von-optima-ab/
  64. http://neue-verpackung.de/66417/spoonie-loeffel-zum-essen-bei-aldi/
    http://neue-verpackung.de/66417/spoonie-loeffel-zum-essen-bei-aldi/
  65. Neue-verpackung Nachhaltigkeit Der Spoonie kommt: Essbarer Löffel bei Aldi
    http://neue-verpackung.de/66417/spoonie-loeffel-zum-essen-bei-aldi/
  66. http://neue-verpackung.de/66416/neopac-gewinnt-auszeichnung-fuer-kosmetikverpackung/
    http://neue-verpackung.de/66416/neopac-gewinnt-auszeichnung-fuer-kosmetikverpackung/
  67. Neue-verpackung Nachhaltige Tube Neopac gewinnt Auszeichnung für Kosmetikverpackung
    http://neue-verpackung.de/66416/neopac-gewinnt-auszeichnung-fuer-kosmetikverpackung/
  68. http://neue-verpackung.de/66415/digitaldruck/
    http://neue-verpackung.de/66415/digitaldruck/
  69. Neue-verpackung Digitaldruck Inline konventionelle und digitale Druckprozesse kombinieren
    http://neue-verpackung.de/66415/digitaldruck/
  70. http://neue-verpackung.de/66413/digitale-wasserzeichen-fuer-lenor-verpackung/
    http://neue-verpackung.de/66413/digitale-wasserzeichen-fuer-lenor-verpackung/
  71. Neue-verpackung Recycling Digitales Wasserzeichen für Lenor-Verpackung
    http://neue-verpackung.de/66413/digitale-wasserzeichen-fuer-lenor-verpackung/
  72. http://neue-verpackung.de/66414/pepsico-deutschland-stellt-2021-auf-recycelte-pet-flaschen-um/
    http://neue-verpackung.de/66414/pepsico-deutschland-stellt-2021-auf-recycelte-pet-flaschen-um/
  73. Neue-verpackung Kreislaufwirtschaft Pepsico Deutschland stellt 2021 auf recycelte PET-Flaschen um
    http://neue-verpackung.de/66414/pepsico-deutschland-stellt-2021-auf-recycelte-pet-flaschen-um/
  74. http://neue-verpackung.de/66411/andreas-zopfi-ist-neuer-geschaeftsfuehrer-des-svi/
    http://neue-verpackung.de/66411/andreas-zopfi-ist-neuer-geschaeftsfuehrer-des-svi/
  75. Neue-verpackung Personen Andreas Zopfi ist neuer Geschäftsführer des Schweizerischen Verpackungsinstituts
    http://neue-verpackung.de/66411/andreas-zopfi-ist-neuer-geschaeftsfuehrer-des-svi/
  76. http://neue-verpackung.de/66410/neues-lifocolor-werk-erfolgreich-in-betrieb/
    http://neue-verpackung.de/66410/neues-lifocolor-werk-erfolgreich-in-betrieb/
  77. Neue-verpackung Masterbatches Neues Lifocolor-Werk erfolgreich in Betrieb
    http://neue-verpackung.de/66410/neues-lifocolor-werk-erfolgreich-in-betrieb/
  78. http://neue-verpackung.de/66409/haeagen-dazs-erfindet-das-trojanische-eis/
    http://neue-verpackung.de/66409/haeagen-dazs-erfindet-das-trojanische-eis/
  79. Neue-verpackung Marketing Häagen-Dazs erfindet das trojanische Eis
    http://neue-verpackung.de/66409/haeagen-dazs-erfindet-das-trojanische-eis/
  80. http://neue-verpackung.de/66406/coop-investiert-in-nachhaltigen-automationsloesung-fuer-distributionszentrum/
    http://neue-verpackung.de/66406/coop-investiert-in-nachhaltigen-automationsloesung-fuer-distributionszentrum/
  81. Neue-verpackung Intralogistik Coop investiert in nachhaltige Automationslösung für Distributionszentrum
    http://neue-verpackung.de/66406/coop-investiert-in-nachhaltigen-automationsloesung-fuer-distributionszentrum/
  82. http://neue-verpackung.de/66405/neste-und-unilever-buendeln-know-how-fuer-chemisches-recycling/
    http://neue-verpackung.de/66405/neste-und-unilever-buendeln-know-how-fuer-chemisches-recycling/
  83. Neue-verpackung Kreislaufwirtschaft Neste, Recycling Technologies und Unilever bündeln Know-how für chemisches Recycling
    http://neue-verpackung.de/66405/neste-und-unilever-buendeln-know-how-fuer-chemisches-recycling/
  84. http://neue-verpackung.de/66402/andreas-koch-ist-neuer-bereichsleiter-druckfarben-bei-zeller-gmelin/
    http://neue-verpackung.de/66402/andreas-koch-ist-neuer-bereichsleiter-druckfarben-bei-zeller-gmelin/
  85. Neue-verpackung Personen Andreas Koch ist neuer Bereichsleiter Druckfarben bei Zeller + Gmelin
    http://neue-verpackung.de/66402/andreas-koch-ist-neuer-bereichsleiter-druckfarben-bei-zeller-gmelin/
  86. http://neue-verpackung.de/66404/pawi-gewinnt-european-carton-excellence-award/
    http://neue-verpackung.de/66404/pawi-gewinnt-european-carton-excellence-award/
  87. Neue-verpackung Auszeichnung Pawi gewinnt European Carton Excellence Award
    http://neue-verpackung.de/66404/pawi-gewinnt-european-carton-excellence-award/
  88. Neue-verpackung Newsticker
    http://neue-verpackung.de/news/
  89. https://www.neue-verpackung.de/e-paper/
    https://www.neue-verpackung.de/e-paper/
  90. http://neue-verpackung.de/whitepaper/neuer-lebensmittel-ibc/
    http://neue-verpackung.de/whitepaper/neuer-lebensmittel-ibc/
  91. Neue-verpackung Neuer Lebensmittel IBC NUTRiline aseptic - Die sterile Transportverpackung für flüssige Lebensmittel
    http://neue-verpackung.de/whitepaper/neuer-lebensmittel-ibc/
  92. http://neue-verpackung.de/whitepaper/formatverstellung-goes-industry-4-0/
    http://neue-verpackung.de/whitepaper/formatverstellung-goes-industry-4-0/
  93. Neue-verpackung LEITFADEN Formatverstellung goes Industry 4.0
    http://neue-verpackung.de/whitepaper/formatverstellung-goes-industry-4-0/
  94. Neue-verpackung Alle Whitepaper
    http://neue-verpackung.de/whitepaper/
  95. Neue-verpackung Vom Quereinsteiger zum Maschinenführer Stanzen/Kleben 26.10.2020 - 76593 Gernsbach
    http://neue-verpackung.de/veranstaltung/vom-quereinsteiger-zum-maschinenfuehrer-stanzen-kleben-76593-gernsbach-papierzentrum-gernsbach-26-10-2020/
  96. Neue-verpackung Einführung in die Konformitätsarbeit und Qualitätssicherung für Papier, Pappe, Karton und Tissue für den Lebensmittelkontakt 27.10.2020 - Online-Event
    http://neue-verpackung.de/veranstaltung/einfuehrung-in-die-konformitaetsarbeit-und-qualitaetssicherung-fuer-papier-pappe-karton-und-tissue-fuer-den-lebensmittelkontakt-online-event-ms-teams-27-10-2020/
  97. Neue-verpackung Cemat Asia 03.11.2020 - Shanghai, China
    http://neue-verpackung.de/veranstaltung/cemat-asia-shanghai-sniec-03-11-2020/
  98. Neue-verpackung Brau Beviale 10.11.2020 - Online-Event
    http://neue-verpackung.de/veranstaltung/braubeviale-nuernberg-messezentrum-10-11-2020/
  99. Neue-verpackung 23. Verpackungsdialog des Deutschen Verpackungsmuseum 12.11.2020 - 69117 Heidelberg
    http://neue-verpackung.de/veranstaltung/23-verpackungsdialog-des-deutschen-verpackungsmuseum-69117-heidelberg-deutsches-verpackungsmuseum-12-11-2020/
  100. Neue-verpackung ALLE VERANSTALTUNGEN
    http://neue-verpackung.de/veranstaltungen/
  101. http://neue-verpackung.de/62895/welches-patent-soll-patent-des-monats-oktober-2020-werden/
    http://neue-verpackung.de/62895/welches-patent-soll-patent-des-monats-oktober-2020-werden/
  102. Neue-verpackung Jetzt abstimmen
    http://neue-verpackung.de/62895/welches-patent-soll-patent-des-monats-oktober-2020-werden/
  103. http://neue-verpackung.de/62896/welche-verpackung-soll-verpackung-des-monats-oktober-2020-werden/
    http://neue-verpackung.de/62896/welche-verpackung-soll-verpackung-des-monats-oktober-2020-werden/
  104. Neue-verpackung Jetzt abstimmen
    http://neue-verpackung.de/62896/welche-verpackung-soll-verpackung-des-monats-oktober-2020-werden/
  105. http://neue-verpackung.de/special/sichere-fernwartung-von-b-r/
    http://neue-verpackung.de/special/sichere-fernwartung-von-b-r/
  106. Neue-verpackung Secure Remote Maintenance Sichere Fernwartung von B&R
    http://neue-verpackung.de/special/sichere-fernwartung-von-b-r/
  107. Neue-verpackung Alle Specials
    http://neue-verpackung.de/special/
  108. Neue-verpackung Bildergalerien
    http://neue-verpackung.de/bildergalerie/
  109. Neue-verpackung Videos
    http://neue-verpackung.de/video/
  110. Neue-verpackung Emissionen senken – Ressourcen schonen Nachhaltig etikettieren und viele Vorteile nutzen 17.04.2020 | Webinar
    http://neue-verpackung.de/webinar/nachhaltig-etikettieren-und-viele-vorteile-nutzen/
  111. Neue-verpackung Geschäftsklima im Verpackungssektor Oktober 2019 Geschäftsklima weiter verschlechtert 28.11.2019 | Galerie - 6 Bilder
    http://neue-verpackung.de/65194/geschaeftsklima-weiter-verschlechtert/
  112. Neue-verpackung Veranstaltung Eindrücke der Praxistagung „Roboter in der Verpackungsindustrie“ 31.10.2019 | Galerie - 14 Bilder
    http://neue-verpackung.de/65107/eindruecke-der-praxistagung-roboter-in-der-verpackungsindustrie/
  113. Neue-verpackung Geschäftsklima im Verpackungssektor September 2019 Geschäftsklimaindex fällt weiter 23.10.2019 | Galerie - 6 Bilder
    http://neue-verpackung.de/65065/geschaeftsklimaindex-faellt-weiter/
  114. Neue-verpackung Geschäftsklima im Verpackungssektor August 2019 Geschäftsklima trübt sich weiter ein 07.10.2019 | Galerie - 6 Bilder
    http://neue-verpackung.de/65010/geschaeftsklima-truebt-sich-weiter-ein/
  115. Neue-verpackung Bilder aus Nürnberg Eindrücke der Fachpack 2019 29.09.2019 | Galerie - 10 Bilder
    http://neue-verpackung.de/64997/eindruecke-der-fachpack-2019/
  116. Neue-verpackung Fachpack 2019, Halle 3: Automation, Robotik, Palettiersysteme, Komponenten 05.09.2019 | Galerie - 13 Bilder
    http://neue-verpackung.de/64892/halle-3-automation-robotik-palettiersysteme-komponenten/
  117. Neue-verpackung Fachpack 2019, Halle 4: Intra- und Verpackungslogistik, Etikettier- und Kennzeichnungstechnik, Umwelttechnik 05.09.2019 | Galerie - 7 Bilder
    http://neue-verpackung.de/64894/halle-4-intra-und-verpackungslogistik-etikettier-und-kennzeichnungstechnik-umwelttechnik/
  118. Neue-verpackung Fachpack 2019, Halle 3A: Pharma und Medizintechnik, Kosmetik 05.09.2019 | Galerie - 7 Bilder
    http://neue-verpackung.de/64893/halle-3a-pharma-und-medizintechnik-kosmetik/
  119. Neue-verpackung Fachpack 2019, Halle 2: Klebstofftechnik 05.09.2019 | Galerie - 11 Bilder
    http://neue-verpackung.de/64891/halle-2-klebstofftechnik/
  120. Neue-verpackung Fachpack 2019, Halle 1: Etikettier- und Kennzeichnungstechnik 05.09.2019 | Galerie - 8 Bilder
    http://neue-verpackung.de/64890/halle-1-etikettier-und-kennzeichnungstechnik/
  121. Neue-verpackung Fachpack 2019, Halle 4A: Intra- und Verpackungslogistik 05.09.2019 | Galerie - 7 Bilder
    http://neue-verpackung.de/64895/halle-4a-intra-und-verpackungslogistik/
  122. Neue-verpackung Fachpack 2019, Halle 5: Papier, Karton, Pappe, Metall 05.09.2019 | Galerie - 4 Bilder
    http://neue-verpackung.de/64896/halle-5-papier-karton-pappe-metall/
  123. Neue-verpackung Fachpack 2019, Halle 6: Flexibler und formgebundener Kunststoff, Holz 05.09.2019 | Galerie - 4 Bilder
    http://neue-verpackung.de/64897/halle-6-flexibler-und-formgebundener-kunststoff-holz/
  124. Neue-verpackung Fachpack 2019, Halle 7: Flexibler und formgebundener Kunststoff 05.09.2019 | Galerie - 13 Bilder
    http://neue-verpackung.de/64898/halle-7-flexibler-und-formgebundener-kunststoff/
  125. Neue-verpackung Fachpack 2019, Halle 7A: Papier, Karton, Pappe 05.09.2019 | Galerie - 5 Bilder
    http://neue-verpackung.de/64899/halle-7a-papier-karton-pappe/
  126. Neue-verpackung Fachpack 2019, Halle 8: Verpackungsdruck und -veredelung, Premiumverpackung 05.09.2019 | Galerie - 4 Bilder
    http://neue-verpackung.de/64900/halle-8-verpackungsdruck-und-veredelung-premiumverpackung/
  127. Neue-verpackung Kennzeichnen in Zeiten von Losgröße 1 Individualisiert Etikettieren und Direktbeschriften 22.02.2019 | Webinar
    http://neue-verpackung.de/webinar/individualisiert-etikettieren-und-direktbeschriften/
  128. Neue-verpackung Effizienter Kennzeichnen Kartons beschriften: So sparen Sie bis zu 70% Kosten 02.03.2018 | Webinar
    http://neue-verpackung.de/webinar/kartons-beschriften-so-sparen-sie-bis-zu-70-kosten/
  129. Neue-verpackung Firmenverzeichnis
    http://neue-verpackung.de/firmen/
  130. Neue-verpackung 0-9
    http://neue-verpackung.de/firmen/?letter=0-9
  131. Neue-verpackung A
    http://neue-verpackung.de/firmen/?letter=A
  132. Neue-verpackung B
    http://neue-verpackung.de/firmen/?letter=B
  133. Neue-verpackung C
    http://neue-verpackung.de/firmen/?letter=C
  134. Neue-verpackung D
    http://neue-verpackung.de/firmen/?letter=D
  135. Neue-verpackung E
    http://neue-verpackung.de/firmen/?letter=E
  136. Neue-verpackung F
    http://neue-verpackung.de/firmen/?letter=F
  137. Neue-verpackung G
    http://neue-verpackung.de/firmen/?letter=G
  138. Neue-verpackung H
    http://neue-verpackung.de/firmen/?letter=H
  139. Neue-verpackung I
    http://neue-verpackung.de/firmen/?letter=I
  140. Neue-verpackung J
    http://neue-verpackung.de/firmen/?letter=J
  141. Neue-verpackung K
    http://neue-verpackung.de/firmen/?letter=K
  142. Neue-verpackung L
    http://neue-verpackung.de/firmen/?letter=L
  143. Neue-verpackung M
    http://neue-verpackung.de/firmen/?letter=M
  144. Neue-verpackung N
    http://neue-verpackung.de/firmen/?letter=N
  145. Neue-verpackung O
    http://neue-verpackung.de/firmen/?letter=O
  146. Neue-verpackung P
    http://neue-verpackung.de/firmen/?letter=P
  147. Neue-verpackung Q
    http://neue-verpackung.de/firmen/?letter=Q
  148. Neue-verpackung R
    http://neue-verpackung.de/firmen/?letter=R
  149. Neue-verpackung S
    http://neue-verpackung.de/firmen/?letter=S
  150. Neue-verpackung T
    http://neue-verpackung.de/firmen/?letter=T
  151. Neue-verpackung U
    http://neue-verpackung.de/firmen/?letter=U
  152. Neue-verpackung V
    http://neue-verpackung.de/firmen/?letter=V
  153. Neue-verpackung W
    http://neue-verpackung.de/firmen/?letter=W
  154. Neue-verpackung X
    http://neue-verpackung.de/firmen/?letter=X
  155. Neue-verpackung Y
    http://neue-verpackung.de/firmen/?letter=Y
  156. Neue-verpackung Z
    http://neue-verpackung.de/firmen/?letter=Z
  157. http://neue-verpackung.de/firma/wipotec-gmbh-kaiserslautern/
    http://neue-verpackung.de/firma/wipotec-gmbh-kaiserslautern/
  158. Neue-verpackung WIPOTEC GmbH
    http://neue-verpackung.de/firma/wipotec-gmbh-kaiserslautern/
  159. http://neue-verpackung.de/firma/breitner-abfuellanlagen-gmbh-schwaebisch-hall-2/
    http://neue-verpackung.de/firma/breitner-abfuellanlagen-gmbh-schwaebisch-hall-2/
  160. Neue-verpackung BREITNER Abfüllanlagen GmbH
    http://neue-verpackung.de/firma/breitner-abfuellanlagen-gmbh-schwaebisch-hall-2/
  161. http://neue-verpackung.de/firma/habasit-gmbh-eppertshausen/
    http://neue-verpackung.de/firma/habasit-gmbh-eppertshausen/
  162. Neue-verpackung Habasit GmbH
    http://neue-verpackung.de/firma/habasit-gmbh-eppertshausen/
  163. Neue-verpackung Alle Firmen
    http://neue-verpackung.de/firmen/
  164. Neue-verpackung Ihre Firma hinzufügen
    https://firmenverzeichnis.neue-verpackung.de/admin/login
  165. Neue-verpackung Lohnverpacker
    https://marktuebersichten.neue-verpackung.de/mu-lohnverpacker
  166. Neue-verpackung Verpackungstechnik
    https://marktuebersichten.neue-verpackung.de/mu-verpackungstechnik
  167. Neue-verpackung Packmittel
    https://marktuebersichten.neue-verpackung.de/mu-packmittel
  168. Neue-verpackung Packmittelherstellung
    https://marktuebersichten.neue-verpackung.de/mu-packmittelherstellung
  169. Neue-verpackung Kennzeichnungstechnik
    https://marktuebersichten.neue-verpackung.de/mu-kennzeichnungstechnik
  170. Neue-verpackung Alle Marktübersichten
    https://marktuebersichten.neue-verpackung.de
  171. Neue-verpackung Zum Stellenmarkt
    http://neue-verpackung.de/stellenmarkt/
  172. http://neue-verpackung.de/hefte/neue-verpackung/10-2020/
    http://neue-verpackung.de/hefte/neue-verpackung/10-2020/
  173. http://neue-verpackung.de/hefte/packaging-international/2016/
    http://neue-verpackung.de/hefte/packaging-international/2016/
  174. http://neue-verpackung.de/hefte/interpack-news/3-2017-deutsch-2/
    http://neue-verpackung.de/hefte/interpack-news/3-2017-deutsch-2/
  175. http://neue-verpackung.de/hefte/fachpack-messeguide/2019/
    http://neue-verpackung.de/hefte/fachpack-messeguide/2019/
  176. http://neue-verpackung.de/hefte/branche-im-fokus/2020-2021/
    http://neue-verpackung.de/hefte/branche-im-fokus/2020-2021/
  177. Neue-verpackung Verpackungsmaschinenund -geräte
    http://neue-verpackung.de/category/themen/verpackungsmaschinen/
  178. Neue-verpackung Verpackungsgestaltungund -design
    http://neue-verpackung.de/category/themen/verpackungsgestaltung-und-design/
  179. Neue-verpackung Mediabereich
    http://neue-verpackung.de/mediabereich/
  180. Neue-verpackung Firmenverzeichnis
    https://firmenverzeichnis.neue-verpackung.de/admin/login
  181. Neue-verpackung Marktübersichten
    https://marktuebersichten.neue-verpackung.de/start
  182. Neue-verpackung Abo-Login
    http://neue-verpackung.de/login
  183. Neue-verpackung Abo abschließen
    http://neue-verpackung.de/abo
  184. Neue-verpackung Leserservice
    http://neue-verpackung.de/leserservice/
  185. Neue-verpackung Hefte
    http://neue-verpackung.de/hefte/
  186. http://neue-verpackung.de/rss/
    http://neue-verpackung.de/rss/
  187. Neue-verpackung Impressum
    http://neue-verpackung.de/impressum/
  188. Neue-verpackung Datenschutz
    http://neue-verpackung.de/datenschutz/
  189. Neue-verpackung Über uns
    http://neue-verpackung.de/ueber-uns/
  190. Neue-verpackung Kontakt
    http://neue-verpackung.de/kontakt/

Links - Internal (nofollow)

0:

Links - Outbound

15:
  1. Neue-verpackung Roboter in der Verpackungsindustrie
    https://www.verpackungs-roboter.de/
  2. Neue-verpackung Packaging Summit
    https://www.packagingsummit.de/
  3. http://www.industriejobs.de
    http://www.industriejobs.de
  4. Neue-verpackung Leiter der Herstellung/Verpackung (m/w/d)über experteer GmbHGroßraum Stuttgart
    http://www.industriejobs.de/Job/Leiter-der-Herstellung-Verpackung-m-w-d.493210815.html?jw_chl_seg=NEUE_VERPACKUNG
  5. Neue-verpackung Ingenieur*in / Bachelorabsolvent*in - Gewinnung und Modifikation von Lebensmittelzutaten / LaborFraunhofer-Institut für Verfahrenstechnik und Verpackung IVVFreising
    http://www.industriejobs.de/Job/Ingenieur-in-Bachelorabsolvent-in-Gewinnung-und-Modifikation-von-Lebensmittelzutaten-Labor.485901245.html?jw_chl_seg=NEUE_VERPACKUNG
  6. Neue-verpackung Technischer Angestellter für Chemische Technologie, Verfahrenstechnik und Maschinenbau (m/w/d)Fraunhofer-Institut für Verfahrenstechnik und Verpackung IVVFreising
    http://www.industriejobs.de/Job/Technischer-Angestellter-fuer-Chemische-Technologie-Verfahrenstechnik-und-Maschinenbau-m-w-d.489654675.html?jw_chl_seg=NEUE_VERPACKUNG
  7. Neue-verpackung Portfolio Manager - Verpackungen (m/w/d)Hays AGNordrhein-Westfalen
    http://www.industriejobs.de/Job/Portfolio-Manager-Verpackungen-m-w-d.484602525.html?jw_chl_seg=NEUE_VERPACKUNG
  8. Neue-verpackung Strategischer Einkäufer (m/w/d) Produktionsmaterial (Kunststoffteile, Verpackungen)Viega Holding GmbH & Co. KGAttendorn
    http://www.industriejobs.de/Job/Strategischer-Einkaeufer-m-w-d-Produktionsmaterial-Kunststoffteile-Verpackungen.489280505.html?jw_chl_seg=NEUE_VERPACKUNG
  9. Neue-verpackung Betriebsleiter (m/w/d)Girrbach Süßwarendekor GmbHCalw-Wimberg
    http://www.industriejobs.de/Job/Betriebsleiter-m-w-d.493148125.html?jw_chl_seg=NEUE_VERPACKUNG
  10. Neue-verpackung Stellenanzeige schalten
    https://industriejobs.smart-schalten.de/kundenportal/public/AnzeigeSchalten;jsessionid=83F245E009D8577CA9C6F5F9AA4FD8A6.ssapp41kp
  11. Neue-verpackung Abo kostenlos testen
    http://fachzeitschriften.shop/epages/65d1d2dd-3aaa-44f8-bf11-12b02b828286.sf/de_DE/?ObjectPath=/Shops/65d1d2dd-3aaa-44f8-bf11-12b02b828286/Products/NVP_PO
  12. Neue-verpackung IVW-geprüft
    http://www.ivw.de/
  13. https://www.xing.com/news/pages/neue-verpackung-861
    https://www.xing.com/news/pages/neue-verpackung-861
  14. https://www.linkedin.com/company/11436493/
    https://www.linkedin.com/company/11436493/
  15. Neue-verpackung AGB
    https://www.huethig.de/agb/

Links - Outbound (nofollow)

0:

Keyword Cloud for Neue-verpackung.de

verpackungpackmittelihrenstellenmarktgmbh amp co2aboveranstaltungenkreislaufwirtschaftverpackungsgestaltung und designgalerie 6unternehmenamp copappeneueverpackungssektorkostenlos abonnieren4recycling13news 22102020newsletter6abonnierenauszeichnungkartonfirmapapier05092019 galerie 7neue verpackungnews 16102020galerie 6 bildergalerie 7vargeschftsklimanewswhitepapervoncogeschftsklima imgalerievon neuedesspecials7 bilder fachpackdigitale7 bilder05092019 galerievon neue verpackungnews 2310202005092019 galerie 4firmenfachpack 2019neuerdieampverfahrenstechnikihren posteingangfachpackfrdirekt in ihrenfachpack 2019 hallepersonen5verpackung direkt6 bilderbilder fachpack 2019galerie 4bilder fachpackbeibilderverpackungsgestaltungnachhaltigegmbhalleprodukte7technik4 bilderdesigndernews 21102020webinar2019 halle8kghallegmbh ampgeschftsklima im verpackungssektormarktbersichtengalerie 4 bilder05092019kostenlosdaskennzeichnungstechnikimdirektnews 19102020lebensmittelproduktberichtposteingangim verpackungssektorneue verpackung direktgalerie 7 bilder0weiter

Longtail Keyword Density for Neue-verpackung.de

KeywordsOccurences
bilder fachpack 201911
fachpack 2019 halle11
von neue verpackung4
verpackungsgestaltung und -design3
neue verpackung direkt3
direkt in ihren3
geschftsklima im verpackungssektor3
galerie 6 bilder3
05092019 galerie 73
galerie 7 bilder3
7 bilder fachpack3
05092019 galerie 43
galerie 4 bilder3
gmbh amp co3
fachpack 201912
05092019 galerie11
2019 halle11
bilder fachpack11
news 191020206
neue verpackung5
news 161020205
von neue4
gmbh amp3
4 bilder3
galerie 43
7 bilder3
galerie 73
galerie 63
6 bilder3
news 221020203
im verpackungssektor3
geschftsklima im3
kostenlos abonnieren3
ihren posteingang3
verpackung direkt3
news 211020203
news 231020203
amp co3
news24
bilder17
galerie16
fr15
015
fachpack12
0509201911
halle11
von10
verpackung8
neue8
der7
packmittel7
var6
16
im6
alle5
das5
kreislaufwirtschaft5
25
geschftsklima5
marktbersichten5
veranstaltungen5
personen4
34
kostenlos4
44
54
gmbh4
co4
des4
64
lebensmittel4
recycling4
stellenmarkt4
whitepaper4
nachhaltige4
-design4
produkte4
firma3
abo3
newsletter3
technik3
kennzeichnungstechnik3
firmen3
unternehmen3
amp3
verpackungsgestaltung3
kg3
verfahrenstechnik3
weiter3
verpackungssektor3
die3
posteingang3
produktbericht3
digitale3
neuer3
73
83
ihren3
bei3
specials3
abonnieren3
auszeichnung3
papier3
pappe3
karton3
webinar3
direkt3

Who hosts Neue-verpackung.de?

Neue-verpackung.de Hosting Provider Information

Hosted IP Address:208.82.73.108
Hosted Hostname:lb-ht-cms.dns.boreus.de
Service Provider:Alaska Communications Systems Group, Inc.
Hosted Country:GermanyDE
Location Latitude:51.2993
Location Longitude:9.491
Webserver Software:Apache

Is "Alaska Communications Systems Group, Inc." in the Top 10 Hosting Companies?

Name
Percentage
GoDaddy.com, LLC
13.8977%
DoD Network Information Center
5.2857%
Amazon.com, Inc.
3.5301%
Confluence Networks Inc
3.5178%
Google Inc.
3.4706%
1&1 Internet AG
1.9908%
TOT Public Company Limited
1.9513%
Unified Layer
1.8987%
OVH SAS
1.7426%
Merit Network Inc.
1.6733%
Alaska Communications Systems Group, Inc.
0.0002%

HTTP Header Analysis for Neue-verpackung.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Sat, 24 Oct 2020 07:06:51 GMT
Server: Apache
Cache-Control: max-age=30
Upgrade: h2
Connection: Upgrade
Expires: Sat, 24 Oct 2020 07:07:21 GMT
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 21825
Content-Type: text/html; charset=UTF-8

Neue-verpackung.de Domain Nameserver Information

HostIP AddressCountry
ns1.boreus.de 195.50.185.7
ns2.boreus.de 46.189.56.7
ns3.boreus.de 85.199.64.7
ns4.boreus.de 18.196.15.34


Need to find out who hosts Neue-verpackung.de?


Domain Registration (WhoIs) information for Neue-verpackung.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: neue-verpackung.de
Nserver: ns1.boreus.de
Nserver: ns2.boreus.de
Nserver: ns3.boreus.de
Nserver: ns4.boreus.de
Status: connect
Changed: 2020-03-23T11:09:12+01:00

Websites with Similar Names

Neue-antenne.com
Antenne Pirmasens - Antenne Pirmasens
Neue-autoteile.com
neue-autoteile.com
Neue-binger-zeitung.de
Neue Binger Zeitung - Rhein Main Wochenblatt
Neue-bodenstaendigkeit.de
Neue Bodenständigkeit – Digitale Heimat
Neue-browsergames.org
Webdesign & Online Marketing aus Regensburg » 3Dreams Medienagentur
Neue-bruecke.org
Neue Brücke e.V. - Internationale Jugendhilfe, Kultur und Dienstleistungen in Deutschland
Neue-caritas.de
neue caritas - Das Magazin des Deutschen Caritasverbandes für Sozial-Profis
Neue-deutsche-musik.com
Start - HANSEBEAT ::: Kulturmanagement
Neue-digitale.net
neue-digitale.net

Recently Updated Websites

Danaspeakman.com 4 seconds ago.Kino-nso.ru 7 seconds ago.Egoldnet.com 9 seconds ago.Dmgroups.se 9 seconds ago.Creatifsoftware.com 11 seconds ago.Goops.ir 14 seconds ago.Bestbitcoinbank.com 16 seconds ago.Sparklevoice.net 16 seconds ago.Ssl-sertifikasi.com 18 seconds ago.Uommamtrituetaichinh.club 19 seconds ago.Allthingshorroronline.net 22 seconds ago.Ritzenhoefer.com 26 seconds ago.Marplehistoricalsociety.org 27 seconds ago.Annabellesuh.com 27 seconds ago.Semelerkoyu.com 31 seconds ago.Dntsystems.com 31 seconds ago.Bank25.ru 32 seconds ago.Alfa30120-alfahosting-server.com 33 seconds ago.Amazonamarketing.com 35 seconds ago.Bmw8033.com 35 seconds ago.Lostosetia.ru 37 seconds ago.Ybytucatu.com.br 37 seconds ago.Metalinstitution.us 37 seconds ago.Counsellingzeeland.nl 39 seconds ago.Piteb.ir 40 seconds ago.Etheredge.net 44 seconds ago.Hollidayhomesdoorsandwindows.com 46 seconds ago.Scarabwater.com.au 47 seconds ago.Homerenovationhamilton.ca 48 seconds ago.Orsosachisays.net 49 seconds ago.