Niden.net  |  niden.net
Low trust score  | 

Niden.net Website Information

Niden.net has a Low Trust Score, a Statvoo Rank of G, an Alexa Rank of 436,947, a Majestic Rank of 0, a Domain Authority of 29% and is not listed in DMOZ.

Niden.net is hosted by Google Inc. in Nebraska, Omaha, United States, 68197.
Niden.net has an IP Address of 216.239.32.21 and a hostname of any-in-2015.1e100.net.

The domain niden.net was registered 1 decade 8 years 7 months ago by GOOGLE INC., it was last modified 4 years 10 months 3 weeks ago and currently is set to expire 4 years 4 months 1 week from now.


Whois information for niden.net

Full Whois Lookup for Niden.net Whois Lookup

Domain Name: NIDEN.NET
Registry Domain ID: 46322678_DOMAIN_NET-VRSN
Registrar WHOIS Server: whois.enom.com
Registrar URL: http://www.enom.com
Updated Date: 2017-01-15T18:48:38Z
Creation Date: 2000-12-06T11:35:44Z
Registry Expiry Date: 2024-12-06T11:35:44Z
Registrar: eNom, Inc.
Registrar IANA ID: 48
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: AMIT.NS.CLOUDFLARE.COM
Name Server: DESI.NS.CLOUDFLARE.COM
DNSSEC: signedDelegation
DNSSEC DS Data: 2371 13 2 807CDC38B88604D3E83F013D439E54F2330AEADEE3BD1ABF85B6F096551EE437
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-09-07T21:39:59Z

Who hosts Niden.net?

Niden.net Web Server Information

Hosted IP Address:216.239.32.21
Hosted Hostname:any-in-2015.1e100.net
Service Provider:Google Inc.
Hosted Country:United StatesUS
Location Latitude:41.2563
Location Longitude:-95.9404
Webserver Software:Not Applicable

HTTP Header Analysis for Niden.net

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Content-Type: text/html; charset=UTF-8
Expires: Mon, 31 Aug 2015 20:13:33 GMT
Date: Mon, 31 Aug 2015 20:13:33 GMT
Cache-Control: private, max-age=0
Last-Modified: Tue, 07 Oct 2014 01:23:46 GMT
ETag: "1928ca99-ed19-46be-9c04-ad039acc673e"
Content-Encoding: gzip
X-Content-Type-Options: nosniff
X-XSS-Protection: 1; mode=block
Content-Length: 6048
Server: GSE


Need to find out who hosts Niden.net?

Niden.net Free SEO Report

Website Inpage Analysis for Niden.net

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:pub-6325600846885391
Google Analytics:Not Applicable

Keyword Cloud for Niden.net

prefacefull namecannotviewbranchesincompatiblevaluesversionwrongspecificsamewe needauthorsunsigned not nullcollatecharsetlatin1installgoingreferencesportcurrenttimestampmodelsfunction getfullnamecdnew3connectiononelocationengineinnodbutf8unicodecierrorreportingeallimplementingchosedueappmysqldumpotherrestart7robotcacheour community02 oct 15createddateetcnull valueoraclethereendemptyopencomedidfilesomesupportedforumneed to runnew lookintodifficulteveryone13timezonetheyqueriesmigraterobotsif notltphplackphp 53publicsayinstalledlifetimegetfullname return trimwidthoptedthosewithoutbareyou canrequesttimehowtodropservicebasewaitingphalcon modelnamecoreallowsif youbootstrapworkingrenamecreatingthankhereint11public function getfullnamebuildtakeusernamealexopen sourcedtriggerdoescamecheck ifetcmysqldoes notgtfollowingrunenhancementsprojectgoogleownconvertunsignedrelatedwe havelogmaster statusndnmodels17severalmethodcpanelperformanceinterfacesmodelaccesslanguagescompaniesappendspublic functionextensionskdebugdigitvalidatorbetweenrdbmsdefault currenttimestampveryinformationlongerdefault nullif wehelpnow correctlydisplayactionhttp proxycommentsvalidationpurposesdefault charsetlatin1 dropcommandsmessageincompatible any referencespowermadeusesfunctionreceivedbloggingadvantagenamespace ndnmodelsallsourcebareupdateimplementationneed to renamestatuspasshave beendyour applicationcorrectlyphalconmvcmodelrepository to gitblog githubreplication useroutputfileskbfixedoptionset up12they cannotcreateslifetime gtwould haveonesinclude02wouldlikeslowkpathreviewingdaysput0400infostringfullnametraitrdsheartbeat2nonegtuse configssloctinitializealthoughrpluseryou mightphalconsecurityuserwentprimarynew way publicphalcon bullcreate tablemodeeffortmore thansoftwareoffertestsnull primary keytraitsmysqlbackendthrownmighthandlerclassesapplicationmodel classmydbfallows uslevelgetfullname returnrowkicksetupcoursewe can4wererdsindexphpproxy serverautomaticallyyour slaverename the functionhosting8additional6enjoyinstancerepositorygrantedchangeguestschangedattentioncouldthreeusedciconiagtaddextensionnewnamespacesvarchar150 collateopensslam goingapi changescustomers searchtimestamp not nulloct 15thusslave mysqlloadedeventaskedcomponentsreturn trimhosting companyinheritancefunction usebasephpamchangesleastcollate utf8unicodeciusefulcreatediddo notmysqlbinchangelog000123function getfullname returnrobotgtname myrobot robotgttypetestbloggit repositorydatetimereleasesneedtakenweb servertrim sprintf sbull returnphalcon blogseeour applicationfieldsexamplecomrequestshost name10bullnull engineinnodb defaultmemorialcallserverloaderroutesproxystopdiscussnotestartdefaultthisgtgetfirstnameprimary keyallowingavailablebootstrappingcontinuehaveclassextensionreallyviewsreplication user wethenparametersmanycalledany referencesbackneededconclusionneedsteamaftergettestaction ifhoweverconstantsflashsessionsimplewe wereuser weaddhelpfulreplicationmorecomposersupportfar1tagsbackwards incompatible anytwonot existsprintf s susthisgtgetlastname thisgtgetfirstname thisgtgetmiddlenamenotdependingreplymustwere notutf8unicodeci default0400info shutdown completedclientphalcon 30worksomethingmastertruefeature requestsourcedmarkdownmemoryserverhttphost examplecom requestgtgethttphostmethodsone canmultiplediserviceswhichdifferentarraypostdisclaimerengineinnodb defaultpostfindertablesnotfoundpluginphalconacladapterinterfaceallowexceptionuse loggercharsetlatin1 drop tableyou needapplicationsway publiccustomerfeatureadditionallydecidednamespace ndnmodels class2not 100getterthanfalsemartinthroughphalconhttpresponseperbitbucketcharsetlatin1 dropcreategit configdebugmodedownfullunsigned notfielddefault 0existalgorithmhasdeleteds s thisgtgetlastnames thisgtgetlastnamereturnsvn repositoryanotherupdatedidbackwardsexecutionchenpretty muchtable if existsphalconcachebackendpartdefault null engineinnodbloggeridvoterecordalwayscontainscan usemyrobot robotgttypeafterfetchnumericmewhilewantpaymentobjectslinesshutdown completedcomputerorderfirstdoexpiredsuchbecausedefinedreturns truedocumentationfeelsprintfyearsmigrationtrim sprintflogsserverhttphostltsfunction testaction ifwayerrorsleftroleguestyou can usetriggerspagesvnabilitybull added abilitythisgtgetlastname thisgtgetfirstnameaccount0400info shutdownmakekb fri 02deprecatedserverscli applicationsinceaddedbaseddownloadwereusegitconnectlinefreedomagopurgeinclude appdirremoveexamplecom requestgtgethttphostautoloaderreplacedbull removedfullyeach tablewe chosefrontcache newjustcustomer searchnextsoreadyaddressbase modelnew waycouplepoststimestampdoes not existrdsreplicationstatusgit bitbuckettakesuserstabledataissuepublic function testactionsomething likedeleteif trueitsthisgtgetmiddlenameflagexistssofthope younull default 0message gtsupvalidatorgtaddgit branchcontactreturn falseprocessphalconcachefrontenddatabase16conditionrobotgttype droidmonthsheightfriflashmodel gtreturn trim sprintfdroidthemthesedanieltagimportlotmcryptfuturegotknowargumenttheirtriedhighpartnersspecifydispatcheruserequiredocumenttestaction if trueengineinnodb default charsetlatin1blog postdesignutf8unicodeci default nullthisgtgetfirstname thisgtgetmiddlenametraceoldnot null defaultwhetherciconiacustomjobsmemorial daymostusingreleasetrimauthorstxt fileuniquenessvalidatorint11 unsignedif you havedelayactiondigtsetconfigurationmappinglittlephalconacladapterinterfacedenystep0days sregisterpushrelevantlatergetfullnamevarchar150 collate utf8unicodeciinsteadmust be numericcurrentthanksrequireseverysourceexampletypeadditionreadframeworkasktraityouapiechocurrentlylongensurehttp methodrouters s spartnerresulthas beenbehaviorinstallationmariadbs thisgtgetlastname thisgtgetfirstnamearticlefoldersecondinvolved11jobnowdatevalidatorphpnulldatedoinghostsshouldbranchkb fridrop table ifroleadminnoactionsifieyour databasevoltno longerfeaturesheaderelsewheresetemailvalidatorcomplexpositionphalconacladapterinterfaceisallowedwe can usenot null primarymasterhostcheckyou haverobotgttypeyourhardwe alsofunctionality15pathcomponentalloweverythingrequestedcore team9keepsetsold wayworking youbull fixedway public functionkeyvalueemployeedelimiterfindernull default currenttimestampdisableyou will needbull addedrenamedtrue echogithubsurethingsrobotgtnamecollate utf8unicodeci defaultfewshutdownnamespaceauroramyusawork foldertrunkmechanismfunction testactionsystemwellbelow11000 truenull defaultouttimestamp notbeforebeingincreasesmachinelooksearchsortphalconhadsettingcommoncloudserverhttphost examplecomonlyuntilauthorstxtpublic function displayactionsoonmasterportvarchar50 notgeneralvarchar150eitherlinks5default charsetlatin1possiblemakingreturnsdi containercliissuesrunningresultsphalconvalidationvalidatoruniquenessmarkstoreandreswebphalcondiemailmentionedphp7frontenddefinitelyincompatible anycoderesourcescasewe will needaws rdscustomersmyselfnecessarybullbullupdateddatefri 02php phalconrobotgtname myrobothttp proxy serverformatcommandconfigevenpleasewantedmysql nonegtdrop tablesecurityparticularsourcerepodoneoptionsbinarycustomer search returnsbitabovemuchskiploggingnew featuresfunction use configfunction displayactionfri 02 octbull fixed issuetimesversion when youwould nothttpmeans14stop working youalsoagainnot nullappdirextendsfew monthsdevelopersreducegivevotesmsgpackthisgtgetlastnameawssearch returnsstillalreadyfixcompatibilityrolesetting upwe decidedfunctionsmaximumbetternamegterrors thrownbeenroleusertable ifits ownphalcon blog githubnew frontendmyrobot robotgttype droidold way publictryconfigphpcreatedenablefactclass customerflash newincludedphalcon teamwe wantvarchar50previousmetricslastif existsslaveerrorprettyshowmyrobot18singlebase model classpersonaldatabasesonceanotherdatevalidatescompletedremovedhopendnmodels classstored02 octrequestgtgethttphostvarchar50 not nulldevelopmentsprintf snull engineinnodblog filedumpquerycommunicationouradded abilityresponsenumberfrontcachetestactionbothseriesundermissingfixed issueparameteranyhandlevalidatorcontentcanhosteachforwardint11 unsigned notfocusstop workingablebutrequest phalconcommunitycompanycontainernull primarybackwards incompatible

Longtail Keyword Density for Niden.net

KeywordsOccurences
fri 02 oct14
-0400info shutdown completed14
02 oct 1514
kb fri 0213
table if exists7
not null default7
drop table if7
engineinnodb default charsetlatin17
default charsetlatin1 drop6
way public function6
collate utf8unicodeci default6
charsetlatin1 drop table6
utf8unicodeci default null6
you will need5
sprintf s s4
s s s4
s s this-gtgetlastname4
trim sprintf s4
we can use4
varchar50 not null4
timestamp not null4
s this-gtgetlastname this-gtgetfirstname4
null default currenttimestamp4
null primary key4
this-gtgetlastname this-gtgetfirstname this-gtgetmiddlename4
unsigned not null4
incompatible any references4
backwards incompatible any4
base model class4
varchar150 collate utf8unicodeci3
public function getfullname3
null default 03
int11 unsigned not3
namespace ndnmodels class3
function getfullname return3
function use config3
phalcon blog github3
version when you3
return trim sprintf3
if you have3
getfullname return trim3
replication user we3
public function testaction3
bull added ability3
new way public3
http proxy server3
serverhttphost examplecom request-gtgethttphost3
bull fixed issue3
old way public3
rename the function3
myrobot robot-gttype droid3
does not exist3
stop working you3
need to rename3
customer search returns3
public function displayaction3
not null primary3
repository to git3
robot-gtname myrobot robot-gttype3
default null engineinnodb3
function testaction if3
testaction if true3
must be numeric3
we will need3
you can use3
need to run3
null engineinnodb default3
bull added38
public function25
not null25
you can22
default null19
bull fixed17
shutdown completed15
we need15
oct 1514
-0400info shutdown14
fri 0214
02 oct14
kb fri13
we have11
have been11
we can10
if true9
can use9
phalcon bull9
mysql nonegt9
null default9
if exists9
phalcon blog9
engineinnodb default8
create table8
table if8
if we8
has been8
s s8
new way7
old way7
if you7
default charsetlatin17
any references7
message gt7
drop table7
charsetlatin1 drop6
blog post6
blog github6
way public6
cli application6
your slave6
would have6
you have6
feature request6
collate utf8unicodeci6
utf8unicodeci default6
function use6
if not6
backwards incompatible6
svn repository5
model class5
primary key5
our application5
namespace ndnmodels5
http method5
git branch5
we want5
not exist5
new look5
do not5
bull removed5
phalcon team4
its own4
log file4
hope you4
aws rds4
we decided4
errors thrown4
incompatible any4
more than4
does not4
git bitbucket4
default currenttimestamp4
varchar50 not4
no longer4
timestamp not4
git repository4
trim sprintf4
work folder4
null primary4
hosting company4
your application4
host name4
customers search4
php phalcon4
this-gtgetlastname this-gtgetfirstname4
di container4
this-gtgetfirstname this-gtgetmiddlename4
s this-gtgetlastname4
unsigned not4
sprintf s4
phalcon 304
check if4
base model4
open sourced3
were not3
full name3
allows us3
pretty much3
web server3
we also3
phalcon model3
one can3
include appdir3
ndnmodels class3
getfullname return3
function getfullname3
default 03
varchar150 collate3
return trim3
class customer3
int11 unsigned3
would not3
use logger3
we were3
they cannot3
memorial day3
am going3
testaction if3
robot-gtname myrobot3
function testaction3
use config3
core team3
myrobot robot-gttype3
robot-gttype droid3
flash new3
request phalcon3
added ability3
working you3
stop working3
11000 true3
lifetime gt3
something like3
our community3
git config3
set up3
authorstxt file3
few months3
api changes3
frontcache new3
new frontend3
you need3
php 533
http proxy3
proxy server3
slave mysql3
null value3
you might3
your database3
setting up3
null engineinnodb3
not 1003
master status3
user we3
replication user3
each table3
new features3
model gt3
now correctly3
customer search3
fixed issue3
examplecom request-gtgethttphost3
serverhttphost examplecom3
search returns3
returns true3
return false3
bull return3
function displayaction3
true echo3
we chose3
we117
bull107
not92
new86
phalcon84
if81
you77
can72
use69
have64
our53
function51
null50
application45
gt45
default43
your43
added41
git39
file35
blog34
need34
using34
now34
all33
php32
one32
mysql31
so31
create30
slave29
true29
return29
class29
public27
replication26
more26
method26
cpanel25
name25
data25
has24
do24
support23
master23
model22
database22
cache22
request21
but21
some21
been21
post21
way20
table20
also20
used20
fixed19
customer19
them18
rds18
their18
set18
log17
completed17
user17
svn17
any17
my17
feature17
config16
time16
very16
customers16
above16
key16
shutdown15
there15
returns15
kb15
they15
015
which15
http15
instance15
work15
114
repository14
cli14
files14
update14
echo14
-0400info14
community14
votes14
only14
0214
oct14
fri14
functionality14
server14
am14
version13
hosting13
message13
would13
available13
no13
false13
exists13
di13
installation13
routes12
code12
its12
well12
since12
check12
view12
dispatcher12
s12
models12
such11
below11
command11
211
references11
up11
into11
other11
note11
get11
cd11
however11
posts11
users11
see11
array11
following11
look11
most10
much10
each10
those10
employee10
information10
configuration10
logger10
connect10
own10
make10
us10
folder10
rdbms10
working10
few10
features9
add9
value9
offer9
exception9
date9
bootstrap9
traits9
github9
like9
nonegt9
just9
loader9
allow9
same9
drop9
status9
error9
etc9
-gt9
removed9
these9
38
framework8
keep8
format8
extension8
response8
lot8
run8
software8
fields8
field8
incompatible8
being8
id8
tables8
decided8
old8
before8
then8
here8
something8
first8
release8
start8
could8
engineinnodb8
performance8
needed8
store8
frontend8
backwards8
future8
custom8
were8
48
needs8
namespace8
different8
bitbucket8
might8
address8
changes7
robot7
than7
volt7
things7
additional7
mysqldump7
team7
robots7
triggers7
postfinder7
payment7
possible7
reply7
install7
charsetlatin17
access7
example7
thus7
deprecated7
based7
once7
making7
string7
57
number7
job7
validator-gtadd7
while7
always7
many7
php77
search7
ciconia-gtaddextensionnew7
include6
created6
called6
updateddate6
source6
machine6
query6
varchar506
renamed6
deleted6
show6
collate6
services6
int116
username6
aws6
validation6
createddate6
errors6
action6
between6
trigger6
related6
type6
taken6
primary6
going6
behavior6
bit6
timestamp6
authorstxt6
every6
utf8unicodeci6
currenttimestamp6
relevant6
router6
try6
getfullname6
record6
day6
openssl6
trait6
mcrypt6
base6
again6
last6
out6
result6
option6
open6
di-gtset6
put6
change6
slow6
whether6
oracle6
validator6
without6
methods6
stored6
want6
bare6
bootstrapping5
enjoy5
applications5
able5
host5
defined5
process5
ensure5
configphp5
series5
common5
path5
automatically5
results5
read5
rpluser5
cannot5
how-to5
autoloader5
location5
execution5
had5
65
comments5
pass5
forum5
objects5
specific5
bullbull5
core5
examplecom5
instead5
does5
ago5
tests5
datetime5
setup5
system5
values5
push5
got5
ssl5
tag5
app5
tags5
company5
came5
help5
mode5
event5
branch5
views5
everything5
running5
end5
exist5
delimiter5
options5
development5
two5
left5
developers5
step5
empty5
conclusion5
ndnmodels5
even5
allows5
markdown5
flash5
because5
web4
phalconvalidationvalidatoruniqueness4
height4
must4
uniquenessvalidator4
long4
thanks4
download4
everyone4
either4
focus4
depending4
effort4
kdebug4
kpath4
debugmode4
basephp4
thrown4
later4
wanted4
finder4
container4
included4
indexphp4
metrics4
memory4
createdid4
unsigned4
updatedid4
received4
partners4
really4
loaded4
ciconia4
feel4
ask4
come4
composer4
emailvalidator4
helpful4
general4
timezone4
creating4
position4
give4
line4
google4
me4
logs4
import4
opted4
means4
sprintf4
this-gtgetlastname4
this-gtgetfirstname4
this-gtgetmiddlename4
trim4
full4
hope4
mariadb4
addition4
pretty4
difficult4
back4
flashsession4
lts4
convert4
msgpack4
rename4
months4
enhancements4
phalconcachebackend4
after4
parameter4
parameters4
sourcebare4
branches4
request-gtgethttphost4
made4
ie4
project4
serverhttphost4
case4
purge4
proxy4
should4
output4
phalconcachefrontend4
build4
connection4
jobs4
interfaces4
expired4
changed4
robot-gtname4
client4
content4
backend4
next4
frontcache4
longer4
74
issues4
takes4
components4
extensions4
implementation4
please4
several4
continue4
already4
84
phalconmvcmodel4
delete4
simple4
argument4
setting4
implementing4
level4
authors4
necessary4
fix4
email4
contains4
resources4
inheritance4
per4
issue4
missing4
handler4
both4
getter4
condition4
appends4
afterfetch4
design3
requested3
security3
asked3
article3
myself3
93
appdir3
reviewing3
handle3
did3
constants3
particular3
migrate3
supported3
errorreportingeall3
couple3
sure3
memorial3
delay3
course3
discuss3
fullnametrait3
kick3
freedom3
usa3
currently3
increases3
links3
hosts3
days3
communication3
partner3
preface3
sourced3
know3
previous3
blogging3
purposes3
contact3
little3
releases3
computer3
varchar1503
complex3
initialize3
sourcerepo3
current3
migration3
mapping3
lines3
trunk3
cloud3
granted3
commands3
sort3
far3
-f3
103
requires3
skip3
still3
definitely3
ready3
personal3
times3
113
compatibility3
tried3
attention3
require3
test3
uses3
fully3
mentioned3
better3
although3
due3
second3
123
-d3
notfoundplugin3
say3
done3
another3
api3
--3
down3
hard3
vote3
years3
went3
sets3
aurora3
maximum3
high3
functions3
classes3
namespaces3
page3
correctly3
involved3
useful3
ltphp3
register3
validates3
disclaimer3
trace3
133
requests3
ones3
least3
disable3
logging3
elsewhere3
forward3
installed3
mechanism3
under3
etcmysql3
account3
martin3
width3
numeric3
datevalidator3
roleguest3
documentation3
anotherdate3
roleuser3
roleadmin3
displayaction3
extends3
wrong3
phalconsecurity3
digitvalidator3
guests3
take3
mark3
andres3
chen3
alex3
daniel3
soft3
queries3
thank3
role3
advantage3
phalconacladapterinterfacedeny3
phalconacladapterinterfaceallow3
phalconacladapterinterfaceisallowed3
phalconhttpresponse3
header3
waiting3
row3
soon3
fact3
lack3
reduce3
algorithm3
chose3
mydb3
until3
doing3
port3
remove3
additionally3
reuse3
single3
component3
call3
namegt3
lifetime3
multiple3
languages3
three3
companies3
143
replaced3
power3
servers3
enable3
flag3
creates3
through3
document3
order3
actions3
service3
testaction3
myrobot3
robot-gttype3
specify3
ability3
stop3
restart3
droid3
rdsheartbeat23
allowing3
-----------------------------------------------------------------------------------------3
153
mysql-bin-changelog0001233
163
databases3
dump3
173
part3
masterport3
masterhost3
rdsreplicationstatus3
183
phalcondi3
binary3

What are the nameservers for niden.net?

Niden.net Domain Nameserver Information

HostIP AddressCountry
ns-cloud-e1.googledomains.com 216.239.32.110United States United States
ns-cloud-e2.googledomains.com 216.239.34.110United States United States
ns-cloud-e3.googledomains.com 216.239.36.110United States United States
ns-cloud-e4.googledomains.com 216.239.38.110United States United States

Niden.net Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Niden.net is a scam?