Gourmetwelten - Gourmetwelten - Das Genussportal

Safety: Low trust score
Year Founded: 2020
Global Traffic Rank: 499,433
Estimated Worth: $1,680
Last updated:2020-10-25
Category: Travel > Tourism

Genussportal der Gourmetwelten mit News über Restaurants und Hotels, Lifestyle, Wein und Reise


Domain summary

Domain label
nikos-weinwelten
Domain extension
de
Global Traffic Rank
499,433
Statvoo Rating
G
Trust Score
Low Trust Score
Estimated worth
$1,680
Estimated daily income
$7
Estimated monthly income
$213

Rank summary

How is nikos-weinwelten.de ranked relative to other sites:

Percentage of visits to nikos-weinwelten.de from a search engine:


Frequently Asked Questions (FAQ)

Q: When was Nikos-weinwelten.de registered?
A: Nikos-weinwelten.de was registered 4 months, 1 week, 9 hours, 46 minutes, 44 seconds ago on Sunday, October 25, 2020.
Q: When was the WHOIS for Nikos-weinwelten.de last updated?
A: The WHOIS entry was last updated 13 years, 5 months, 2 weeks, 3 days, 9 hours, 46 minutes, 44 seconds ago on Friday, September 14, 2007.
Q: What are Nikos-weinwelten.de's nameservers?
A: DNS for Nikos-weinwelten.de is provided by the following nameservers:
  • ns.second-ns.com
  • ns1.your-server.de
  • ns3.second-ns.de
Q: Who is the registrar for the Nikos-weinwelten.de domain?
A: The domain has been registered at DENIC eG.
Q: What is the traffic rank for Nikos-weinwelten.de?
A: Nikos-weinwelten.de ranks 499,433 globally on Alexa. Nikos-weinwelten.de has a Low Trust Score, and a Statvoo Rank of G.
Q: How many people visit Nikos-weinwelten.de each day?
A: Nikos-weinwelten.de receives approximately 1,163 visitors and 2,326 page impressions per day.
Q: What IP address does Nikos-weinwelten.de resolve to?
A: Nikos-weinwelten.de resolves to the IPv4 address 213.133.104.70.
Q: In what country are Nikos-weinwelten.de servers located in?
A: Nikos-weinwelten.de has servers located in the Germany.
Q: What webserver software does Nikos-weinwelten.de use?
A: Nikos-weinwelten.de is powered by Apache webserver.
Q: Who hosts Nikos-weinwelten.de?
A: Nikos-weinwelten.de is hosted by Hetzner Online GmbH in Bavaria, Nuremberg, Germany, 90409.
Q: How much is Nikos-weinwelten.de worth?
A: Nikos-weinwelten.de has an estimated worth of $1,680. An average daily income of approximately $7, which is roughly $213 per month.

Nikos-weinwelten.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Nikos-weinwelten.de Free SEO Report

Website Related Search Terms

Website Inpage Analysis for Nikos-weinwelten.de

H1 Headings

12 :
  1. Côtes du Rhône im Weinladen Schmidt
  2. WEIN am LIMIT: SÜDAFRIKA SPEZIAL
  3. Sofitel Berlin am Kurfürstendamm
  4. Weinladen Schmidt - Drink Pink!
  5. Wein am Limit: Neue Online-Verkostungen
  6. COSY AT HOME plus Pommery Brut Rosé
  7. Rosé-Cup: Die besten Rosé für den Sommer
  8. Tenuta Biodinamica Mara - Sonne & Mond
  9. WEIN am LIMIT mit Kalifornien Spezial
  10. BERLIN BRODELT - DIE STADT KOCHT
  11. Von den Machern von SASH&FRITZ
  12. RELAIS & CHÂTEAU SCHLOSSHOTEL HOHENHAUS

H2 Headings

25 :
  1. Sternerestaurant einsunternull Berlin Fünfjähriges
  2. NEUES RESTAURANT VON KULL & WEINZIERL brenner kitchen
  3. Johann Lafer, Eckart Witzigmann Eine Freundschaft – 100 Rezepte
  4. Weihnachtsfeiern Viele Firmen verzichten
  5. Emmeramsmühle und Corona-Schließung Versicherung muss entschädigen
  6. Dorint Kurfürstendamm Berlin Übernahme am Kudamm
  7. Tag des österreichischen Sekts Prohaska lässt es prickeln
  8. BRLO BRWHOUSE Berlin Pop-Up Zelt im Biergarten
  9. Radisson Hotel Group Radisson Individuals
  10. Sechs Sterneköche, zwölf Gerichte Helios präsentiert Kochbuch
  11. Restaurant eins44 in Berlin Tim Tanneberger geht
  12. Hotelier Finkbeiner aus der Traube Tonbach «Ich weiß gar nicht, wie ich darauf reagieren soll.»
  13. Restaurant theNOname Sommelier Steve Hartzsch geht
  14. Deutscher Rotweinpreis 2020 Sieger ist das Weingut Rings
  15. Fleesensee Hotel- & Sportresort Die Millionen-Investition
  16. Garküchen in Berlin werden legalisiert Der Thai-Streetfoodmarkt
  17. Ausgangssperre im Berchtesgadener Land Der Quasi-Lockdown
  18. Gerolsteiner WeinPlaces Fünf neue Weinbars
  19. Heizpilze in Gastronomie Bund fördert
  20. Restaurant Tim Raue Zertifizierung für hygienisch sichere Restaurants
  21. Restaurant Bonvivant in Berlin Lässig vegetarisch!
  22. Johann Lafer präsentiert Nudel-Webinar World Pasta Day
  23. Hotel Hohenhaus Kaviar und Champagner-Wochenende
  24. Richtig Sake trinken Japanisches Food-Pairing
  25. Steigenberger Hotels Wechsel in Bad Neuenahr und Konstanz

H3 Headings

0 :

H4 Headings

0 :

H5 Headings

0 :

H6 Headings

0 :

Total IFRAMEs

0 :

Total Images

75 :

Google Adsense

:
Not Applicable

Google Analytics

:
Not Applicable

Links - Internal

109:

Links - Internal (nofollow)

7:

Links - Outbound

16:

Links - Outbound (nofollow)

10:

Keyword Cloud for Nikos-weinwelten.de

61limitimgroupeinedersichvomdiesemammit dembarseinchampagnerwochenende2weiterlesentimwein am limitoktobersteigenbergerrestaurants22 oktoberden2020 imamp20 oktober 2020werdenich25 oktober17 oktoberhohenhausihrehatgerolsteiner weinplaces3aufweinplacesgerolsteiner20 oktoberdasam limitzuausweiterlesen restaurantfuumlrweinrestauranthotelsradisson hotel2020 daswein am25 oktober 202045mitwirdjohann laferberlin0neuesseitvon21 oktoberwie21 oktober 2020hotel grouphoteldemistjohannradisson hotel groupbrloradissonesoktober 2020 dasrauedieeinemlaferoktober 2020des17 oktober 2020

Who hosts Nikos-weinwelten.de?

Nikos-weinwelten.de Hosting Provider Information

Hosted IP Address:213.133.104.70
Hosted Hostname:www70.your-server.de
Service Provider:Hetzner Online GmbH
Hosted Country:GermanyDE
Location Latitude:49.4475
Location Longitude:11.0683
Webserver Software:Apache

Is "Hetzner Online GmbH" in the Top 10 Hosting Companies?

Name
Percentage
DoD Network Information Center
15.4872%
GoDaddy.com, LLC
9.2224%
Namecheap, Inc.
3.8991%
Google Inc.
2.8555%
Confluence Networks Inc
2.6870%
Amazon.com, Inc.
1.9936%
Merit Network Inc.
1.8570%
1&1 Internet AG
1.8247%
TOT Public Company Limited
1.6908%
Squarespace, Inc.
1.5625%
Hetzner Online GmbH
0.5480%

HTTP Header Analysis for Nikos-weinwelten.de

Http-Version: 1.1
Status-Code: 301
Status: 301 Moved Permanently
Date: Sun, 25 Oct 2020 09:28:47 GMT
Server: Apache
Location: https://nikos-weinwelten.de/
Cache-Control: max-age=0
Expires: Sun, 25 Oct 2020 09:28:47 GMT
Content-Length: 305
Content-Type: text/html; charset=iso-8859-1

Nikos-weinwelten.de Domain Nameserver Information

HostIP AddressCountry
ns.second-ns.com 213.239.204.242
ns1.your-server.de 213.133.106.251
ns3.second-ns.de 193.47.99.4


Need to find out who hosts Nikos-weinwelten.de?


Domain Registration (WhoIs) information for Nikos-weinwelten.de

 % Restricted rights.
%
% Terms and Conditions of Use
%
% The above data may only be used within the scope of technical or
% administrative necessities of Internet operation or to remedy legal
% problems.
% The use for other purposes, in particular for advertising, is not permitted.
%
% The DENIC whois service on port 43 doesn't disclose any information concerning
% the domain holder, general request and abuse contact.
% This information can be obtained through use of our web-based whois service
% available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%
%

Domain: nikos-weinwelten.de
Nserver: ns.second-ns.com
Nserver: ns1.your-server.de
Nserver: ns3.second-ns.de
Status: connect
Changed: 2007-09-14T02:40:56+02:00

Websites with Similar Names

Nikos-bau.com
Neue Website
Nikos-e.ru
?????? ??? ????, ?????? ?????? ? ????????-???????? ?????????????
Nikos-georgopoulos.com
Nikos Georgópoulos
Nikos-gyros.com
Niko's Gyros - The Best Gyros In The Lake Country Area
Nikos-hosting.com
Nikos Hosting CS Serveri Srbija - Counter-Strike 1.6 Premium i Lite serveri i hosting, VPS serveri i web hosting
Nikos-kalatzis.com
Default Parallels Plesk Page
Nikos-kelly.wedding
Νίκος & Κέλλυ

Recently Updated Websites

Symbioticcannabis.com (2 seconds ago.)Nastitetedug.monster (4 seconds ago.)Gridict.info (5 seconds ago.)Newbostonlandscapingco.com (6 seconds ago.)Denparts.com (7 seconds ago.)Sportsbookcassino.com (7 seconds ago.)Cryptointel.org (10 seconds ago.)Kellyandpanek.com (12 seconds ago.)Globalsdwanroi.com (12 seconds ago.)Hyperfuture.international (15 seconds ago.)Voiceinthehead.com (15 seconds ago.)Xtremerep.com (16 seconds ago.)Specialtybicycle.com (17 seconds ago.)Sunbrelli.com (18 seconds ago.)Wiidee.com (19 seconds ago.)Frenoalacoso.com (20 seconds ago.)Design-mark-industries.com (21 seconds ago.)Caffeoslo.nl (22 seconds ago.)Seattledesignco.com (22 seconds ago.)Blue-harp.com (25 seconds ago.)Racetrac.asia (26 seconds ago.)Cookieandjar.com (26 seconds ago.)Millertherealtor.com (27 seconds ago.)Higherpowerups.info (27 seconds ago.)Vamultifamily.com (28 seconds ago.)Patriotminutemen.com (30 seconds ago.)Springcreektownhomes.com (31 seconds ago.)Mahuvision.org.nz (32 seconds ago.)Bayicecream.com (33 seconds ago.)Fatni-bbq.com (34 seconds ago.)

Recently Searched Keywords

tại sao khách hàng tin tưởng lựa chọn dịch vụ của du lịch khát vọng việt (2 seconds ago.)0 ii (3 seconds ago.)marketing business intelligence (8 seconds ago.)preferences backgroundcolorcsrfalseviewnamespacetemplatesimagetexttemplateshadowfalsepreset11promotitle (28 seconds ago.)enim ipsam voluptatem (29 seconds ago.)0 24 (31 seconds ago.)《光明日报》报道青年农机专家王东伟致力花生机械装备研发 (40 seconds ago.)808217li (44 seconds ago.)holy quran in urdu (48 seconds ago.)-x-x (51 seconds ago.)обзор msi gf75 thin 9sc. тонкий, лёгкий и по нормальной цене (53 seconds ago.)全球 (54 seconds ago.)üçlü karışım çim tohumu (59 seconds ago.)visiting millionaire (1 minute 1 second ago.)vietnam descen nameru (1 minute 12 seconds ago.)مراقبت در برابر آفتاب (1 minute 15 seconds ago.)-5vh (1 minute 17 seconds ago.)jai vigneshwara builders poonamallee chennai (1 minute 21 seconds ago.)united statesoptionsgreen (1 minute 24 seconds ago.)lal kitab upay for husband (1 minute 24 seconds ago.)cost imagination (1 minute 26 seconds ago.)google play kod hilesi (1 minute 27 seconds ago.)sg.oklute.com (1 minute 28 seconds ago.)nomad pizza 7th street (1 minute 37 seconds ago.)temperli cam duşa kabin (1 minute 40 seconds ago.)оплата доставки получателем (1 minute 41 seconds ago.)sg.oklute.com (1 minute 44 seconds ago.)how do we collect helium (1 minute 45 seconds ago.)-1 8 (1 minute 45 seconds ago.)nomad street kid corpo (1 minute 51 seconds ago.)