|  Nők Lapja Café
Low trust score  | 
Nők Lapja Cafe a mi helyünk Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:E
Alexa Rank Alexa Rank:7,932
Majestic Rank Majestic Rank:116,644
Domain Authority Domain Authority:59%
DMOZ DMOZ Listing:No

Domain Information for

Domain Registrar: HUNIC
Registration Date:2001-04-21  1 decade 7 years 10 months ago

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

% Whois server 2.08d serving the hu ccTLD

record created: 2001.04.21 03:01:24
További adatokért ld.:
For further data see:

Who hosts is hosted by Enternet 2001 Ltd. in Hungary. has an IP Address of and a hostname of and runs nginx/1.9.6 web server. Web Server Information

Hosted IP Address:
Service Provider:Enternet 2001 Ltd.
Hosted Country:HungaryHU
Location Latitude:47.4925
Location Longitude:19.0514
Webserver Software:nginx/1.9.6

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 09 Jun 2015 19:37:26 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip
W: w07
Content-Length: 25413
Content-Type: text/html; charset=UTF-8

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

semmagyarorszgmitfunctionszigettrendhogy egymentkmeztelenlegjobblaksszexmindigezrtlehetresizegallerygrg zitataggingerr ifjnlttlcukihanemklnemnlcafnem lttltagging tagginglogerr2rdemeskzbennkmertamikorif tagging tagginglogerrteljesnzedtveserr if taggingvilgon08nagyobbparlagfamelylemagyarazhetierrtagging tagginglogerr trynlklrltfotkvalakicsakjnminketezt nzedimagewidthmost prgprgmargithogyanwindowlocationhashszigetentagginglogerrif taggingnetermszetakkorkvetkezolyanhoroszkpvanezittkispercmegallergialaczkegyotthonvidetrtntif windowlocationhashakinekvekkpeszitasmost0catch err ifeztamitmr1truevarkvess minketvannakkotnyektagginglogerr tryszoptatsbalatontekellfacebooksofrkigykvessleszvagynyrcatch erregyrevolnahogygyerekgalleryidwindowfbqmamagyarorszg klifakiksoknekem a balatonlegnagyobbrgieltbbottnekemanykembermagyarorszgonnagyalattmggaldobozida9f71677a1582347cb28333be1105da0cafeblogaztmg tbb60asamivgrecatchnapitwitterfrfiaknlcconfigislayoutrightelgwidthegyikszexulistrystatsentnincselkpesztnlcconfigislayoutright truecsaldhagrgjlvolt

Longtail Keyword Density for

catch err if36
if tagging tagginglogerr36
err if tagging36
tagging tagginglogerr try19
nekem a balaton3
tagging tagginglogerr36
catch err36
if tagging36
err if36
tagginglogerr try19
nlcconfigislayoutright true12
mg tbb11
ezt nzed10
most prg7
grg zita4
if windowlocationhash3
kvess minket3
magyarorszg kl3
hogy egy3
nem lttl3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Hungary States United States Hungary Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if is a scam?