Nlcafe.hu  |  N?k Lapja Café
Low trust score  | 
N?k Lapja Cafe a mi helyünk

Nlcafe.hu Website Information

Nlcafe.hu has a Low Trust Score, a Statvoo Rank of E, an Alexa Rank of 7,932, a Majestic Rank of 116,644, a Domain Authority of 59% and is not listed in DMOZ.

Nlcafe.hu is hosted by Enternet 2001 Ltd. in Hungary.
Nlcafe.hu has an IP Address of 77.111.91.26 and a hostname of w06.sanomaonline.hu and runs nginx/1.9.6 web server.

The domain nlcafe.hu was registered 1 decade 8 years 5 months ago by HUNIC, it was last modified 201 decades 8 years 11 months ago and currently is set to expire 201 decades 8 years 11 months ago.


Whois information for nlcafe.hu

Full Whois Lookup for Nlcafe.hu Whois Lookup

% Whois server 2.08d serving the hu ccTLD

domain: nlcafe.hu
record created: 2001.04.21 03:01:24
Tovbbi adatokrt ld.:
http://www.domain.hu/domain/domainsearch/
For further data see:
http://www.domain.hu/domain/English/domainsearch/

Who hosts Nlcafe.hu?

Nlcafe.hu Web Server Information

Hosted IP Address:77.111.91.26
Hosted Hostname:w06.sanomaonline.hu
Service Provider:Enternet 2001 Ltd.
Hosted Country:HungaryHU
Location Latitude:47.4925
Location Longitude:19.0514
Webserver Software:nginx/1.9.6

HTTP Header Analysis for Nlcafe.hu

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 09 Jun 2015 19:37:26 GMT
Server: Apache
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Vary: Accept-Encoding
Content-Encoding: gzip
W: w07
Content-Length: 25413
Content-Type: text/html; charset=UTF-8


Need to find out who hosts Nlcafe.hu?

Nlcafe.hu Free SEO Report

Website Inpage Analysis for Nlcafe.hu

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Nlcafe.hu

mertmeztelennekemlegjobbrltkotnyeklaczkcatch err ifmost prgleszexulistagginglakskihetinem lttlcatch errnlcafsokgalleryidwidthkzbenvanakkorkisstatsenttrendfacebookfunctionkvessazttryegylehetmacsaldteljeseztpercszigetencsaknemgyereknlcconfigislayoutright trueklnlcconfigislayoutright081nkvoltamitlegnagyobbnjlhoroszkpgrg zitamindigvilgonzitavagywindowlocationhashmegresizegalleryfrfiakimagewidthmagyarorszg klsemszexmargitazgymagyarorszgkpesmgezt nzedtagging tagginglogerrolyankvess minketelkpesztfotkvek0ittifkellezrtvolnanapitruegaldobozida9f71677a1582347cb28333be1105da0otttwitternlklgrgamelymosthogyanprgszoptatshogy egyakineknyrtrtnttenejnhaerr if taggingnincserr ifszigettbbveslttlamitermszetsofrrdemeserrnzedanykvarvgreegyrestagging tagginglogerr trynagyobbleszmitvideegyikbalatonallergiaelotthonhanem2tagginglogerr try60ascafeblogvannakvalakicatchjhogyrgiakiknagyezif windowlocationhashemberparlagftwindowfbqminkettagginglogerrcukikvetkezmagyarorszgonelgamikormagyarmg tbbif taggingmrif tagging tagginglogerrmentknekem a balatonalatt

Longtail Keyword Density for Nlcafe.hu

KeywordsOccurences
catch err if36
if tagging tagginglogerr36
err if tagging36
tagging tagginglogerr try19
nekem a balaton3
tagging tagginglogerr36
catch err36
if tagging36
err if36
tagginglogerr try19
nlcconfigislayoutright true12
mg tbb11
ezt nzed10
most prg7
grg zita4
if windowlocationhash3
kvess minket3
magyarorszg kl3
hogy egy3
nem lttl3
az63
if43
catch36
tagging36
tagginglogerr36
try36
err36
s36
nem35
egy34
hogy24
mg20
tbb17
ki15
true15
ezt14
meg14
nlcconfigislayoutright12
var12
most11
gy11
nlcaf11
ha10
nzed10
ez10
volt9
horoszkp9
mr9
ves9
amit8
prg8
sziget7
mit7
ami7
el7
csak7
nk7
balaton7
06
j6
vide6
legjobb6
alatt6
teljes6
napi6
width6
magyar5
vagy5
grg5
sem5
magyarorszg5
van5
csald5
amikor5
15
egyre5
vek4
zita4
trtnt4
hanem4
n4
kell4
le4
akinek4
function4
lehet4
jl4
nyr4
elg4
szex4
minket4
facebook4
24
azt4
fotk4
valaki4
mert4
windowfbq4
akkor4
gyerek4
imagewidth3
ma3
windowlocationhash3
statsent3
magyarorszgon3
rlt3
lttl3
laks3
olyan3
kzben3
lesz3
laczk3
cuki3
legnagyobb3
galdobozida9f71677a1582347cb28333be1105da03
rdemes3
margit3
60-as3
kotnyek3
cafeblog3
allergia3
resizegallery3
termszet3
szoptats3
meztelen3
nekem3
galleryid3
trend3
sofr3
heti3
otthon3
egyik3
ember3
ott3
itt3
perc3
nagyobb3
szexulis3
te3
volna3
szigeten3
vilgon3
hogyan3
nagy3
nlkl3
amely3
frfiak3
nincs3
elkpeszt3
rgi3
jn3
mindig3
vannak3
vgre3
kpes3
mentk3
kl3
ezrt3
parlagf3
akik3
083
sok3
ne3
kis3
kvetkez3
anyk3
twitter3
kvess3
t3

What are the nameservers for nlcafe.hu?

Nlcafe.hu Domain Nameserver Information

HostIP AddressCountry
ns1.p24.hu 77.111.90.197Hungary Hungary
ns2.p24.hu 52.29.191.123United States United States
ns3.p24.hu 188.227.227.218Hungary Hungary

Nlcafe.hu Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Nlcafe.hu is a scam?