Website Information

Website Ranks & Scores for

Statvoo Rank Statvoo Rank:B
Alexa Rank Alexa Rank:16,568
Majestic Rank Majestic Rank:779
Domain Authority Domain Authority:89%
DMOZ DMOZ Listing:No

Whois information for

Full Whois Lookup for Whois Lookup

WHOIS is a query and response protocol that is widely used for querying databases that store the registered users or assignees of an Internet resource, such as a domain name, an IP address block, or an autonomous system, but is also used for a wider range of other information. Below is the entire whois information for Many domains these days use a WHOIS privacy service to hide the actual email addresses and owner of a domain.

Registry Domain ID: D2213820-LROR
Registrar WHOIS Server:
Registrar URL:
Updated Date: 2017-07-22T21:50:29Z
Creation Date: 1998-10-17T04:00:00Z
Registry Expiry Date: 2017-10-16T04:00:00Z
Registrar Registration Expiration Date:
Registrar: Alice's Registry, Inc.
Registrar IANA ID: 275
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: ok
Registry Registrant ID: C151938871-LROR
Registrant Name: Nobel Foundation Rights Association
Registrant Organization: Nobel Foundation Rights Association
Registrant Street: Box 5232
Registrant City: Stockholm
Registrant State/Province:
Registrant Postal Code: 10245
Registrant Country: SE
Registrant Phone: +46.86632765
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: Login to show email
Admin ID: C151938870-LROR
Admin Name: Hans Mehlin
Admin Organization: Nobel Foundation Rights Association
Admin Street: Box 5232
Admin City: Stockholm
Admin State/Province:
Admin Postal Code: 10245
Admin Country: SE
Admin Phone: +46.86632761
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: Login to show email
Tech ID: C151938872-LROR
Tech Name: hiq
Tech Organization: Nobel Foundation Rights Association
Tech Street: Norra Hamngatan 22
Tech City: Goteborg
Tech State/Province:
Tech Postal Code: 41106
Tech Country: SE
Tech Phone: +46.317439100
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: Login to show email
Name Server: NS1.FROBBIT.SE
Name Server: NS2.FROBBIT.SE
Name Server: NS3.FROBBIT.SE
DNSSEC: signedDelegation
URL of the ICANN Whois Inaccuracy Complaint Form:
>>> Last update of WHOIS database: 2017-08-16T06:55:03Z

Who hosts is hosted by Teleservice Bredband Skane AB in Värmland, Skane, Sweden. has an IP Address of and a hostname of Web Server Information

Hosted IP Address:
Service Provider:Teleservice Bredband Skane AB
Hosted Country:SwedenSE
Location Latitude:59.0831
Location Longitude:12.9331
Webserver Software:Not Applicable
Google Map of 50,12

Websites Hosted on Same IP (i.e.

Bokförlaget Tranan

  18,822,151   $ 8.95

  1,397,655   $ 720.00

Frobbit | Domännam, DNS, Webhotell

  1,869,817   $ 480.00

De sju stegen | Kontroll av identitet, id-handlingar, kort för...

  Not Applicable   $ 8.95


  4,107,869   $ 240.00

HTTP Header Analysis for

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache/2.2.15 (CentOS)
X-Powered-By: PHP/5.3.3
Vary: Accept-Encoding
Content-Encoding: gzip
Content-Length: 14281
Content-Type: text/html; charset=UTF-8
Expires: Wed, 17 Jun 2015 15:12:33 GMT
Cache-Control: max-age=0, no-cache, no-store
Pragma: no-cache
Date: Wed, 17 Jun 2015 15:12:33 GMT
Connection: keep-alive

Need to find out who hosts Free SEO Report

Website Inpage Analysis for

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for

physicsleftheight mathroundleftheightitsprize in physicsbeen awardedchemistryhavefactsmathroundrightheighthighestmathroundleftheightliunobelmiddlecolheighthighestmidtagoreifwindowwidth 780 calculateoctoberlectureorganizationsifmiddleheight highest highestalexei abrikosovvar middleheightabrikosovdiscoverednobelleftcolheight vartimeslook righthighest highest middleheightprize awardedhighest middleheight ifrightheightmiddleheight mathroundmiddleheight varrightheight mathroundrightheight ifwindowwidthifmiddleheightpassesteacher summitprize laureatepeace prize prizewomenkarlifrightheight highest highestselectedgotoyearteacherearliestpassed awayall nobelvar rightheightleftheightnobelmiddlecolheighthighestmid nobelrightcolheighthighesttermsrightheight nobelrightcolheighthasmiddleheight mathroundmiddleheightvar middleheight nobelmiddlecolheightprize in economicmakehadsciencesleftheight nobelleftcolheight varnobelleftcolheighthighestkarl landsteinerselectedgotoprizenobel prizesliteraturecuriephysics prizetheoryphotobiographyoctober 1145october 1145 amrightcreatelistcontaineryocssdisplayleftheight ifmiddleheight highestnobel prize awardedusfacebookmedicineseeifwindowwidth 780nobelprizeworldnobel teacher summitright highest leftheighteinsteinalfredvarhighest leftheightleftheight ifmiddleheightnobel laureatespeace prize laureatevar leftheight nobelleftcolheightconcertnobel peace prizemathroundrightheight ifwindowwidth 780centerlandsteinereconomic sciencescontainersgamenobel peace1highest highestleftheight nobelleftcolheightvar rightheight nobelrightcolheight2ourawaylaureatevar leftheightvar highestmid highest20laserifrightheight highestfalsemarie curienobel centermathroundmiddleheightalbert einsteinhighestmid highest20am780 calculatehighest rightheight varlook right highestnobelleftcolheightcalculate the heightprize prizehans4summeralexeihighest rightheightright highestrightheightcalculatepassedmiddleheight ifrightheighthisrightheight mathroundrightheighthighest middleheightnobelsrightsifrightheightlisteninglifenobel prize1145 amprize in literatureplayifmiddleheight highestsummer listeningeconomicprizesawarded the nobelswedencontainers and makemoreifwindowwidthcopyrightalfred nobelearliest the nobelvideohumanidnobelleftcolheight var leftheightawardedchildvar highestmidmarienominationjoinmathroundmiddleheight varrightheight varpressweredogmathroundmiddleheight var rightheightsciencetimequestions0middleheight ifrightheight highestnobelrightcolheighthighesthighestmidxiaobonobelmiddlecolheightnobelrightcolheightrightheight var highestmidhighest leftheight ifmiddleheightnobel foundationshehighest highest rightheightlaureatesnobel teachereventsreadagemiddleheight nobelmiddlecolheightalbertsummitbloodheightpeace prizebeenjoin uspasses awaymathroundrightheight ifwindowwidthpeaceelsealfred nobelsspeechliu xiaobomiddleheighthighest20herecreatelistformvisiblemake it look3foundationleftalllook

Longtail Keyword Density for

nobel peace prize10
prize in economic6
awarded the nobel6
prize in physics5
earliest the nobel4
highest leftheight ifmiddleheight3
ifmiddleheight highest highest3
right highest leftheight3
leftheight ifmiddleheight highest3
make it look3
containers and make3
highest highest middleheight3
look right highest3
ifrightheight highest highest3
rightheight var highestmid3
var highestmid highest203
highest rightheight var3
highest highest rightheight3
middleheight ifrightheight highest3
calculate the height3
highest middleheight ifrightheight3
rightheight mathroundrightheight ifwindowwidth3
nobel teacher summit3
var leftheight nobel-left-colheight3
nobel prize awarded3
peace prize laureate3
october 1145 am3
prize in literature3
leftheight nobel-left-colheight var3
nobel-left-colheight var leftheight3
peace prize prize3
mathroundrightheight ifwindowwidth 7803
var rightheight nobel-right-colheight3
mathroundmiddleheight var rightheight3
var middleheight nobel-middle-colheight3
middleheight mathroundmiddleheight var3
ifwindowwidth 780 calculate3
nobel prize28
peace prize13
nobel peace11
alfred nobel10
nobel prizes9
nobel laureates7
var leftheight7
economic sciences7
highest highest6
var middleheight5
var rightheight5
nobel center4
nobel foundation4
all nobel4
rightheight var3
rightheight mathroundrightheight3
highest rightheight3
ifrightheight highest3
var highestmid3
rightheight nobel-right-colheight3
nobel-middle-colheighthighestmid nobel-right-colheighthighest3
mathroundmiddleheight var3
highestmid highest203
mathroundrightheight ifwindowwidth3
ifwindowwidth 7803
ifmiddleheight highest3
middleheight mathroundmiddleheight3
middleheight ifrightheight3
leftheight ifmiddleheight3
highest leftheight3
780 calculate3
look right3
right highest3
highest middleheight3
passes away3
prize laureate3
liu xiaobo3
passed away3
prize awarded3
1145 am3
october 11453
physics prize3
prize prize3
alfred nobels3
join us3
been awarded3
summer listening3
alexei abrikosov3
leftheight nobel-left-colheight3
nobel-left-colheight var3
leftheight mathroundleftheight3
teacher summit3
nobel teacher3
marie curie3
karl landsteiner3
albert einstein3
middleheight nobel-middle-colheight3

What are the nameservers for Domain Nameserver Information

HostIP AddressCountry Sweden Sweden States United States DNS Record Analysis DNS Lookup

Serial: 2015061100
Refresh: 36000
Retry: 3600
Expire: 604800
nobelprize.orgMX3600Priority: 10
nobelprize.orgMX3600Priority: 20
nobelprize.orgAAAA3589IPV6: 2a02:80:3ffe::39

Alexa Traffic Rank for

Alexa Search Engine Traffic for