Nordkirche.de  |  nordkirche.de
Low trust score  | 
Die Evangelisch-Lutherische Kirche in Norddeutschland ist die Evangelische Landeskirche in den Bundesländern Hamburg, Mecklenburg-Vorpommern und Schleswig-Holstein

Nordkirche.de Website Information

Nordkirche.de has a Low Trust Score, a Statvoo Rank of H, an Alexa Rank of 851,834, a Majestic Rank of 525,046, a Domain Authority of 60% and is not listed in DMOZ.

Nordkirche.de is hosted by [email protected] Internet Informationssysteme GmbH in Hamburg, Hamburg, Germany, 22081.
Nordkirche.de has an IP Address of 212.12.38.188 and a hostname of nordkirche.de.

The domain nordkirche.de was registered 201 decades 8 years 9 months ago by , it was last modified 7 years 8 months 2 weeks ago and currently is set to expire 201 decades 8 years 9 months ago.


Whois information for nordkirche.de

Full Whois Lookup for Nordkirche.de Whois Lookup

% Copyright (c) 2010 by DENIC
% Version: 2.0
%
% Restricted rights.
%
% Terms and Conditions of Use
%
% The data in this record is provided by DENIC for informational purposes only.
% DENIC does not guarantee its accuracy and cannot, under any circumstances,
% be held liable in case the stored information would prove to be wrong,
% incomplete or not accurate in any sense.
%
% All the domain data that is visible in the whois service is protected by law.
% It is not permitted to use it for any purpose other than technical or
% administrative requirements associated with the operation of the Internet.
% It is explicitly forbidden to extract, copy and/or use or re-utilise in any
% form and by any means (electronically or not) the whole or a quantitatively
% or qualitatively substantial part of the contents of the whois database
% without prior and explicit written permission by DENIC.
% It is prohibited, in particular, to use it for transmission of unsolicited
% and/or commercial and/or advertising by phone, fax, e-mail or for any similar
% purposes.
%
% By maintaining the connection you assure that you have a legitimate interest
% in the data and that you will only use it for the stated purposes. You are
% aware that DENIC maintains the right to initiate legal proceedings against
% you in the event of any breach of this assurance and to bar you from using
% its whois service.
%
% The DENIC whois service on port 43 never discloses any information concerning
% the domain holder/administrative contact. Information concerning the domain
% holder/administrative contact can be obtained through use of our web-based
% whois service available at the DENIC website:
% http://www.denic.de/en/domains/whois-service/web-whois.html
%

Domain: nordkirche.de
Nserver: ns1.delink.de
Nserver: ns2.delink.de
Nserver: ns3.delink.de
Nserver: ns4.delink.de
Status: connect
Changed: 2017-01-31T10:45:03+01:00

[Tech-C]
Type: ROLE
Name: Hostmaster of the Day
Organisation: deLink GmbH
Address: Alsterblick 35
PostalCode: 22397
City: Hamburg
CountryCode: DE
Phone: +49 40 64413700
Fax: +49 40 64419431
Email: Login to show email
2016-12-07T12:17:04+01:00

[Zone-C]
Type: ROLE
Name: Hostmaster of the Day
Organisation: deLink GmbH
Address: Alsterblick 35
PostalCode: 22397
City: Hamburg
CountryCode: DE
Phone: +49 40 64413700
Fax: +49 40 64419431
Email: Login to show email
2016-12-07T12:17:04+01:00

Who hosts Nordkirche.de?

Nordkirche.de Web Server Information

Hosted IP Address:212.12.38.188
Hosted Hostname:nordkirche.de
Service Provider:[email protected] Internet Informationssysteme GmbH
Hosted Country:GermanyDE
Location Latitude:53.576
Location Longitude:10.047
Webserver Software:Not Applicable

HTTP Header Analysis for Nordkirche.de

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: Apache
Vary: Accept-Encoding
Content-Encoding: gzip
Access-Control-Expose-Headers: Content-Range
Content-Type: text/html; charset=utf-8
Content-Length: 21467
Accept-Ranges: bytes
Date: Wed, 09 Sep 2015 01:21:03 GMT
X-Varnish: 1475329956 1475322795
Age: 5810
Via: 1.1 varnish
Connection: keep-alive
X-Cache: HIT


Need to find out who hosts Nordkirche.de?

Nordkirche.de Free SEO Report

Website Inpage Analysis for Nordkirche.de

H1 Headings:0
H2 Headings:0
H3 Headings:0
H4 Headings:0
H5 Headings:0
H6 Headings:0
Total IFRAMEs:0
Total Images:0
Google Adsense:Not Applicable
Google Analytics:Not Applicable

Keyword Cloud for Nordkirche.de

rostock heiligenschwerinevluthst marienjohanneskirchengemeindest petrigemeindest nikolaischlokirchengemeindepetrusgemeinde schwerinevluth schlokirchengemeindest jacobihauptkirchepetrigreifswaldev bugenhagengemeinde greifswald4 wochendiejacobihauptkirche st katharinenhauptkircheheiligen geistevluth kirchengemeindejakobi lbeckevluth kirchengemeindeflensburghamburghauptkirche stnikolailbeckevluth kirchengemeinde stim nordengreifswaldgertrudehrenamtlichelutherstandreasgemeindeistrostockkirchedaskirchemonatemichaelunserezu lbeckrostockevluth innenstadtgemeindepressemitteilungen0800kirchengemeinde rostockstseitejacobi greifswaldev kirchengemeindebugenhagengemeinde greifswald wieckeldenaevschwerinevluth kirchengemeinde bernojohanneskirchengemeinde greifswaldev kirchengemeindeorteorteflensburgevluthkatharinenhauptkirchebischfinandreasdomgemeinde schwerinevluthwochendiest johannisuhrjohannis rostockevluthgreifswaldev johanneskirchengemeinde greifswaldevgeistevluth kirchengemeinde rostockevershagenevluthsiediemonatediegeistevluthwochedienikolaihauptkirchejohannisevluth kirchengemeinde stwieckeldenaev christuskirchengemeindeflensburgst johannisevluth kirchengemeindefrdomgemeinde schwerinevluth kirchengemeindedrst michaelflensburgevluthlutherstandreasgemeinde rostockkirche warnemndeschleswigevluthkleinevluth kirchengemeindemarienlbeckstbischofst jacobibugenhagengemeinde greifswaldkirchengemeinde st jacobinchsten 3der3 monatedie nchstenwochendie nchstennachrichtenrostockst michaelishauptkirchekirchengemeinde schleswigschwerinevluth domgemeinde1kirchengemeinde rostocklttenengagementrostockltten kleinevluth kirchengemeindesehenrostockevluth kirchengemeindezu flensburgevluth kirchengemeindemarien in lbeckstst michaelishauptkirche strostockevluth kirchengemeinde rostocknikolaikirchengemeinde flensburgevluthlbeckrostockevluth innenstadtgemeinde rostockevluthkirchengemeinde st aegidienschlokirchengemeinde schwerinevluthschleswigschwerinevluth domgemeindemonatedie nchsten 6johannis rostockevluth lutherstandreasgemeindepetrusgemeindemarien zu flensburgevluthrostockevershagenevluthzu lbeckrostockevluthchristuskirchengemeinde greifswaldev johanneskirchengemeindegreifswaldev kirchengemeindeschwerinevluth petrusgemeindenikolai greifswaldkiellbeckdom zukirchengemeinde rostockevershagenevluth kirchengemeindejacobi greifswaldevst gertrud zugertrud zu flensburgevluthflensburgevluth st nikolaikirchengemeinderostockevluth lutherstandreasgemeinde rostockkircherundgreifswaldev johanneskirchengemeindenchsten 3 monatedieinnenstadtgemeindebernoflensburghamburghauptkirche st jacobihauptkirchest nikolai greifswaldkiellbeckdomorteorteflensburgevluth kirchengemeindekirchengemeinde rostockevershagenevluthgreifswaldev kirchengemeinde stnikolaihauptkirche st petrigreifswaldevmehr erfahrenberno schwerinevluthnikolai schwerinevluth petrusgemeindeheiligenwarnemndeschleswigevluth kirchengemeindest aegidienzu lbeckevlutherfahren3 monatediemichaelishauptkirche stlandesbischofvarjohannisevluthvershnungskirchengemeindezu flensburgevluthrostockevershagenevluth kirchengemeindeinnenstadtgemeinde rostockevluth kirchengemeinderostockkirche warnemndeschleswigevluth kirchengemeindelutherstandreasgemeinde rostockkircheschleswigschwerinevluthnikolaihauptkirche stkatharinenhauptkirche stzu lbeckevluth kirchengemeindest nikolai schwerinevluthkirchengemeinde flensburgst johannisevluthflensburgst johannisevluthnchsten 40nikolai schwerinevluthheiligen geistevluthbildkirchengemeinde st michaelst aegidien zust jacobihauptkirche stst marien greifswaldevnikolaikirchengemeindekirchengemeinde st gertrudst gertrudst katharinenhauptkirche sthauptbereichflensburgevluth st petrigemeindewochedie nchsten 4gottesdiensteaegidien zu lbeckevluthwieckeldenaev christuskirchengemeinde greifswaldevschleswigschwerinevluth domgemeinde schwerinevluthkirchengemeinde st jakobiberkirchengemeinde rostock heiligenst jakobiwochedie nchsten6 monatenikolaikirchengemeinde flensburgevluth stgreifswaldevpetrigemeindenordenberno schwerinevluth kirchengemeindekirchengemeinde berno schwerinevluthrostockevluthaegidienlbeckst petri zuwarnemndeschleswigevluthpetrist nikolaikirchengemeindeschwerinevluth schlokirchengemeindeaegidien zuschwerinevluth kirchengemeindest johannis rostockevluthjacobihauptkirchesehen siezurwochendie nchsten 32hamburggreifswald wieckeldenaev christuskirchengemeindedenorteorteflensburgevluth kirchengemeinde flensburgstkirchengemeinde schleswigschwerinevluthchristuskirchengemeinde greifswaldevmarien greifswaldevrostockkirche warnemndeschleswigevluthflensburgevluth kirchengemeindekontaktrostockltten kleinevluthkirchengemeindelbeckevluth kirchengemeindewarnemndeschleswigevluth kirchengemeinde schleswigschwerinevluthrostockevershagenevluth kirchengemeinde rostocklttennchsten 6 monateschwerinevluth kirchengemeinde stst petrigreifswaldevschwerinevluth petrusgemeinde schwerinevluthlbeckevluthimflensburgstst nikolaihauptkirchepetrigreifswaldev bugenhagengemeindemeinekirchengemeinde bernolbeckrostockevluth innenstadtgemeindeveranstaltungenvonmichael in flensburgevluthst jakobi lbeckevluthpetrigemeinde in flensburghamburghauptkirchelbeckst petrilbeckrostockevluthmehrzuim bildkirchengemeinde st marienjakobiflensburgevluth stpetrigreifswaldevmichaelishauptkirche st nikolaihauptkircheflensburgevluth kirchengemeinde stgertrud zupetri zugreifswaldkiellbeckdom zu lbeckevluthjohannisjohannisevluth kirchengemeindeaufberatungjacobihauptkirche stschwerinevluth schlokirchengemeinde schwerinevluthmarien greifswaldev kirchengemeinde4 wochendie nchstengreifswaldkiellbeckdomrostocklttenkatharinenhauptkirche st michaelishauptkircheangebotekirchengemeinde st nikolainchsten 6rostockevluth lutherstandreasgemeindekirchengemeinde st johannisrostock heiligen geistevluthst nikolaihauptkirche stkirchengemeinde rostockltten kleinevluthst jacobi greifswaldevst katharinenhauptkirchemarien zugreifswald wieckeldenaevflensburghamburghauptkirchewieckeldenaevder landessynodebugenhagengemeindedr andreasmichaelishauptkirchest marien zust nikolaikirchengemeinde flensburgevluthlandessynodejacobinchsten 4 wochendiedomgemeindegreifswaldkiellbeckdom zuschwerinevluth vershnungskirchengemeindepetrusgemeinde schwerinevluthchristuskirchengemeindejohanneskirchengemeinde greifswaldevst petrigreifswaldev bugenhagengemeindekleinevluth kirchengemeinde stjakobi lbeckevluthgeistevluth kirchengemeindenordkirchenchstennikolai greifswaldkiellbeckdommonatedie nchsteninnenstadtgemeinde rostockevluthkirchengemeinde flensburgstschlokirchengemeinde schwerinevluth vershnungskirchengemeindekirchengemeinde stkleinevluthpetri zu lbeckrostockevluth

Longtail Keyword Density for Nordkirche.de

KeywordsOccurences
lbeckev-luth kirchengemeinde st12
kirchengemeinde st marien12
greifswaldev kirchengemeinde st12
zu lbeckev-luth kirchengemeinde8
kirchengemeinde st nikolai8
zu flensburgev-luth kirchengemeinde8
flensburgev-luth kirchengemeinde st8
st jakobi lbeckev-luth4
rostockev-luth kirchengemeinde rostock4
nchsten 3 monatedie4
3 monatedie nchsten4
monatedie nchsten 64
heiligen geistev-luth kirchengemeinde4
rostock heiligen geistev-luth4
kirchengemeinde rostock heiligen4
zu lbeckrostockev-luth innenstadtgemeinde4
innenstadtgemeinde rostockev-luth kirchengemeinde4
lbeckrostockev-luth innenstadtgemeinde rostockev-luth4
st johannis rostockev-luth4
petri zu lbeckrostockev-luth4
lbeckst petri zu4
marien in lbeckst4
jakobi lbeckev-luth kirchengemeinde4
kirchengemeinde st johannis4
rostockev-luth luther-st-andreas-gemeinde rostockkirche4
johannis rostockev-luth luther-st-andreas-gemeinde4
schwerinev-luth kirchengemeinde st4
nchsten 4 wochendie4
wochedie nchsten 44
schlokirchengemeinde schwerinev-luth vershnungskirchengemeinde4
schwerinev-luth schlokirchengemeinde schwerinev-luth4
petrusgemeinde schwerinev-luth schlokirchengemeinde4
schwerinev-luth petrusgemeinde schwerinev-luth4
nikolai schwerinev-luth petrusgemeinde4
st nikolai schwerinev-luth4
berno schwerinev-luth kirchengemeinde4
kirchengemeinde st jakobi4
kirchengemeinde berno schwerinev-luth4
schwerinev-luth kirchengemeinde berno4
domgemeinde schwerinev-luth kirchengemeinde4
schleswigschwerinev-luth domgemeinde schwerinev-luth4
kirchengemeinde schleswigschwerinev-luth domgemeinde4
warnemndeschleswigev-luth kirchengemeinde schleswigschwerinev-luth4
rostockkirche warnemndeschleswigev-luth kirchengemeinde4
luther-st-andreas-gemeinde rostockkirche warnemndeschleswigev-luth4
kirchengemeinde flensburg-st johannisev-luth4
kirchengemeinde st aegidien4
aegidien zu lbeckev-luth4
flensburgev-luth st nikolai-kirchengemeinde4
st katharinenhauptkirche st4
jacobihauptkirche st katharinenhauptkirche4
st jacobihauptkirche st4
flensburghamburghauptkirche st jacobihauptkirche4
petrigemeinde in flensburghamburghauptkirche4
flensburgev-luth st petrigemeinde4
nikolai-kirchengemeinde flensburgev-luth st4
st nikolai-kirchengemeinde flensburgev-luth4
michael in flensburgev-luth4
st michaelishauptkirche st4
kirchengemeinde st michael4
marien zu flensburgev-luth4
st marien zu4
gertrud zu flensburgev-luth4
st gertrud zu4
kirchengemeinde st gertrud4
johannisev-luth kirchengemeinde st4
flensburg-st johannisev-luth kirchengemeinde4
katharinenhauptkirche st michaelishauptkirche4
michaelishauptkirche st nikolaihauptkirche4
st aegidien zu4
christus-kirchengemeinde greifswaldev johannes-kirchengemeinde4
wochendie nchsten 34
marien greifswaldev kirchengemeinde4
st marien greifswaldev4
jacobi greifswaldev kirchengemeinde4
st jacobi greifswaldev4
kirchengemeinde st jacobi4
johannes-kirchengemeinde greifswaldev kirchengemeinde4
greifswaldev johannes-kirchengemeinde greifswaldev4
wieck-eldenaev christus-kirchengemeinde greifswaldev4
st nikolaihauptkirche st4
greifswald wieck-eldenaev christus-kirchengemeinde4
bugenhagengemeinde greifswald wieck-eldenaev4
petrigreifswaldev bugenhagengemeinde greifswald4
st petrigreifswaldev bugenhagengemeinde4
nikolaihauptkirche st petrigreifswaldev4
4 wochendie nchsten4
nikolai greifswaldkiellbeckdom zu3
st nikolai greifswaldkiellbeckdom3
nchsten 6 monate3
orteorteflensburgev-luth kirchengemeinde flensburg-st3
kleinev-luth kirchengemeinde st3
rostock-ltten kleinev-luth kirchengemeinde3
kirchengemeinde rostock-ltten kleinev-luth3
rostock-evershagenev-luth kirchengemeinde rostock-ltten3
kirchengemeinde rostock-evershagenev-luth kirchengemeinde3
geistev-luth kirchengemeinde rostock-evershagenev-luth3
greifswaldkiellbeckdom zu lbeckev-luth3
kirchengemeinde st44
lbeckev-luth kirchengemeinde12
greifswaldev kirchengemeinde12
st marien12
schwerinev-luth kirchengemeinde8
zu lbeckev-luth8
st nikolai8
flensburgev-luth st8
flensburgev-luth kirchengemeinde8
zu flensburgev-luth8
im norden5
schwerinev-luth vershnungskirchengemeinde4
innenstadtgemeinde rostockev-luth4
st johannis4
geistev-luth kirchengemeinde4
heiligen geistev-luth4
rostock heiligen4
kirchengemeinde rostock4
rostockev-luth kirchengemeinde4
nchsten 34
rostockev-luth luther-st-andreas-gemeinde4
lbeckrostockev-luth innenstadtgemeinde4
zu lbeckrostockev-luth4
petri zu4
3 monatedie4
monatedie nchsten4
nchsten 64
johannis rostockev-luth4
luther-st-andreas-gemeinde rostockkirche4
schlokirchengemeinde schwerinev-luth4
schwerinev-luth petrusgemeinde4
wochedie nchsten4
nchsten 44
4 wochendie4
schwerinev-luth schlokirchengemeinde4
petrusgemeinde schwerinev-luth4
wochendie nchsten4
nikolai schwerinev-luth4
rostockkirche warnemndeschleswigev-luth4
berno schwerinev-luth4
kirchengemeinde berno4
jakobi lbeckev-luth4
domgemeinde schwerinev-luth4
schleswigschwerinev-luth domgemeinde4
kirchengemeinde schleswigschwerinev-luth4
warnemndeschleswigev-luth kirchengemeinde4
lbeckst petri4
aegidien zu4
st jakobi4
nikolai-kirchengemeinde flensburgev-luth4
st michaelishauptkirche4
st katharinenhauptkirche4
jacobihauptkirche st4
st jacobihauptkirche4
flensburghamburghauptkirche st4
st petrigemeinde4
st nikolai-kirchengemeinde4
st nikolaihauptkirche4
st michael4
marien zu4
gertrud zu4
st gertrud4
johannisev-luth kirchengemeinde4
flensburg-st johannisev-luth4
kirchengemeinde flensburg-st4
michaelishauptkirche st4
katharinenhauptkirche st4
nikolaihauptkirche st4
wieck-eldenaev christus-kirchengemeinde4
st aegidien4
marien greifswaldev4
jacobi greifswaldev4
st jacobi4
johannes-kirchengemeinde greifswaldev4
st petrigreifswaldev4
christus-kirchengemeinde greifswaldev4
greifswaldev johannes-kirchengemeinde4
greifswald wieck-eldenaev4
bugenhagengemeinde greifswald4
petrigreifswaldev bugenhagengemeinde4
rostock-evershagenev-luth kirchengemeinde3
kirchengemeinde rostock-ltten3
rostock-ltten kleinev-luth3
im bild3
kleinev-luth kirchengemeinde3
kirchengemeinde rostock-evershagenev-luth3
orteorteflensburgev-luth kirchengemeinde3
mehr erfahren3
der landessynode3
dr andreas3
sehen sie3
6 monate3
nikolai greifswaldkiellbeckdom3
greifswaldkiellbeckdom zu3
st72
kirchengemeinde66
zu24
schwerinev-luth20
greifswaldev16
flensburgev-luth16
im15
die13
nchsten13
der13
marien12
lbeckev-luth12
fr8
nikolai8
rostockev-luth8
hauptbereich7
das6
dr6
sie6
nordkirche6
05
norden5
kirche5
15
25
beratung5
christus-kirchengemeinde4
jacobi4
wieck-eldenaev4
greifswald4
aegidien4
jakobi4
lbeckst4
petri4
johannes-kirchengemeinde4
luther-st-andreas-gemeinde4
lbeckrostockev-luth4
berno4
var4
monatedie4
wochendie4
wochedie4
vershnungskirchengemeinde4
schlokirchengemeinde4
petrusgemeinde4
domgemeinde4
innenstadtgemeinde4
schleswigschwerinev-luth4
warnemndeschleswigev-luth4
rostockkirche4
petrigreifswaldev4
johannis4
geistev-luth4
heiligen4
rostock4
bugenhagengemeinde4
petrigemeinde4
nikolaihauptkirche4
auf4
michaelishauptkirche4
meine4
bischof4
landessynode4
veranstaltungen4
erfahren4
flensburg-st4
johannisev-luth4
gertrud4
michael4
nikolai-kirchengemeinde4
flensburghamburghauptkirche4
jacobihauptkirche4
katharinenhauptkirche4
von4
landesbischof3
ber3
greifswaldkiellbeckdom3
den3
sehen3
monate3
zur3
bild3
unsere3
08003
uhr3
bischfin3
ehrenamtliche3
andreas3
engagement3
gottesdienste3
angebote3
kleinev-luth3
rostock-ltten3
rostock-evershagenev-luth3
pressemitteilungen3
nachrichten3
hamburg3
kontakt3
seite3
ist3
mehr3
orteorteflensburgev-luth3
rund3

What are the nameservers for nordkirche.de?

Nordkirche.de Domain Nameserver Information

HostIP AddressCountry
hulk.work.de 213.178.67.30Germany Germany
ns.work.de 212.12.32.174Germany Germany

Nordkirche.de Reviews

We don't have any reviews for this website yet.

You could be the first to write one!

Add your review

Need to find out if Nordkirche.de is a scam?